(data stored in ACNUC7421 zone)

EMBL: CP002355.PE386

CP002355.PE386       Location/Qualifiers
FT   CDS_pept        complement(383886..385040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0488 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33054"
FT                   /db_xref="GOA:E4TZ55"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ55"
FT                   /protein_id="ADR33054.1"
FT                   /translation="MKALAFLFFFLGQILLAEPSVLTDPAPAPVTATEETTAAPTVETD
FT                   VNALFSGVSTTAGLTLQFSDLPSHPYVGEIIPVTVKLTPVDIASGNIEYTLQNEEGIRI
FT                   FSDTPRRSVKEDGVYDTFYFLVQSSSIRFPDITATLTSTGSVTEPLIGTALNAIPLSPP
FT                   SGFANVLADKFEVINYKTTPYNNESNVVIFTVKASRCNIGDFSIPNAIKQGFESKFSNV
FT                   GESQMTYYAIIPNTEQNLNFSFFNLKKQRYESIVIPIVVDDDTVSTQSDLSPTDARHTE
FT                   LKISAAAVVVAVLFGLFYWRRDKWYLYASSLPMFYIVYALLPNPTICVKKDAPIYLLPI
FT                   KNGTIFEMTLQEEHLEAEKEVGEFIKVHLDDKVGWVNKRDLCSN"
     ttgaaagctc tagcttttct ttttttcttt ctaggacaaa tccttttagc ggaaccgtcc        60
     gttcttacag atccggctcc ggcacctgta accgcgacgg aggaaactac tgccgctccg       120
     actgttgaga cagatgtaaa tgcacttttt tccggtgttt ccactaccgc aggattgacg       180
     cttcagttca gcgatctccc ctcacatccc tatgtcgggg aaattatccc tgttaccgtc       240
     aaacttactc cggttgatat agcttccgga aacatcgaat atactcttca aaacgaagag       300
     gggattcgaa ttttcagcga tacaccgcgc agaagcgtaa aagaagacgg tgtatacgac       360
     acattctatt ttctggttca atcctcatcc atccgctttc ccgatattac ggcaacgctc       420
     acatcgaccg gaagcgtcac cgagcccctt atcggaacgg ctttaaatgc gatacctctc       480
     agtccgccct cagggtttgc aaacgtttta gccgataagt tcgaggttat taattacaaa       540
     acaactccgt ataataatga aagcaacgtc gttattttca cagttaaggc atcgcgatgt       600
     aacatcggag acttctccat tcctaatgcg atcaagcaag gtttcgaatc gaaattctcc       660
     aatgtcggcg aatcgcagat gacctattat gccattatcc ccaatacgga acaaaacctc       720
     aatttttcat ttttcaatct taaaaagcaa cgatatgagt cgattgtcat tccgattgtc       780
     gtggatgacg ataccgtctc tacccaaagc gatctctcac cgaccgatgc acgccatacc       840
     gaacttaaaa tcagcgccgc ggcagtggta gtagcggttc ttttcggatt attttattgg       900
     agacgggata aatggtacct ttatgcttcg tcattaccga tgttttatat cgtatatgcc       960
     ctccttccga atccgaccat atgtgtcaaa aaagatgcgc cgatctattt gcttccaatc      1020
     aaaaacggca caatttttga aatgacgctc caagaagaac atttggaagc cgaaaaagag      1080
     gtcggagaat tcattaaggt acatctcgat gataaagtag gatgggttaa taaacgtgat      1140
     ctttgctcga attaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page