(data stored in ACNUC7421 zone)

EMBL: CP002355.PE387

CP002355.PE387       Location/Qualifiers
FT   CDS_pept        complement(385037..385711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0388"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0047 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase glutamine amidotransferase domain; InterPro
FT                   IPR010075: IPR017926; KEGG: tdn:Suden_0489
FT                   phosphoribosylformylglycinamidine synthase I; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR:
FT                   Phosphoribosylformylglycinamidine (FGAM) synthase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33055"
FT                   /db_xref="GOA:E4TZ56"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ56"
FT                   /protein_id="ADR33055.1"
FT                   /translation="MKVGIIQFPGTNCEYDTQHAFAALGCETQILWHKEDTIPSDMDLV
FT                   VAAGGFSYGDYLRSGAIAKMSPIMKALKVYAENGGKVLGICNGFQVLTETGLLPGALKR
FT                   NEGLHFISRHHHLKVINNDNIFLRHCNVDQVLNIPIAHHDGNFYIDEHGLQELYANGQV
FT                   LLKYTDEKGNIDNPNGSVDSIAGICNKSKNVFGLMPHPERAMETLLGSDDGKAMLEGFI
FT                   NA"
     atgaaagtcg gcatcatcca atttccggga accaactgtg aatacgatac ccagcatgcg        60
     tttgccgcat tagggtgcga aacacaaatt ctttggcaca aagaggatac tatcccttcc       120
     gatatggact tggtagtagc cgcaggcgga ttcagctacg gagattacct tcgcagcggt       180
     gccattgcca aaatgtctcc gatcatgaaa gcccttaaag tctatgcaga gaacggcgga       240
     aaagtcttag gaatctgtaa cggatttcag gtattgaccg aaaccggtct tcttccgggt       300
     gcattgaaac gtaatgaagg gcttcacttc atttcacgcc atcaccatct caaagtcatt       360
     aacaacgata atatttttct tcgccattgc aacgttgatc aggttctaaa catccctatc       420
     gcgcatcacg acgggaattt ttacattgat gagcacggtt tgcaagagct gtatgcgaat       480
     ggccaggtat tgcttaaata tactgacgaa aaagggaaca tcgataatcc gaacggttct       540
     gtcgacagta ttgccggtat ctgtaacaaa agcaaaaacg ttttcggttt aatgcctcat       600
     ccggaacgcg ctatggaaac tcttttaggc tcggatgacg gcaaagcgat gttagagggg       660
     tttataaacg cttga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page