(data stored in ACNUC7421 zone)

EMBL: CP002355.PE390

CP002355.PE390       Location/Qualifiers
FT   CDS_pept        complement(386668..387990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0391"
FT                   /product="carboxyl-terminal protease"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR004447: IPR001478: IPR005151; KEGG: tdn:Suden_0492
FT                   peptidase S41A, C-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SPTR: Periplasmic protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: Peptidase family
FT                   S41; PDZ domain (Also known as DHR or GLGF); TIGRFAM:
FT                   C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33058"
FT                   /db_xref="GOA:E4TZ59"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ59"
FT                   /protein_id="ADR33058.1"
FT                   /translation="MKNTKMMVVGFVSAVAVSLILSTSLFAKNTVAAPTEASVEASRLQ
FT                   SLAKFTKVLSIVEQYNVDGLTVDQLIDKSLQGMLSNLDAHSTYMDKKSYDNLKTQTDGE
FT                   FGGLGITVGMRDNALTVIAPIEGTPADKAGIKAGDIILKINDKSTLSMTIDDAVSIMRG
FT                   APKTPIDLTIVRKGLADPLKIHIIRDIITVQSVYTRNISGNILYIRVTSFDKKVAADVK
FT                   KAIKKYSGKSKGIILDLRNNPGGLLDQAVDLTDLFVDEGIIVSQKGRNKADDMTYKATK
FT                   SNTITDLPLVVLVNEGSASASEIVSGALQDLKRAVIVGEKTFGKGSVQVVMPITETEGI
FT                   KLTVARYYLPSGRTIQAVGVTPDIEVAAGEIKKHEKSFNIKEADLKEHLVSELEKSDGM
FT                   IDVTEANATNKTVITPEQMNRDIQLKEGVDIIKALIIVKGK"
     atgaaaaaca caaaaatgat ggtagtcggt tttgtcagtg ccgtagcggt tagtctcatc        60
     ctgtcgacat cactgtttgc aaaaaacacc gttgccgcac ctactgaagc ctctgtagaa       120
     gcctcacgtc tccaatcgct cgctaaattt acgaaagtct tgagcattgt cgagcaatac       180
     aacgtagacg gtcttaccgt cgatcaactc attgacaaat cgctgcaggg gatgctctcc       240
     aatctcgatg cccattctac ctatatggac aaaaaaagct acgacaatct aaaaacacaa       300
     accgacggtg aattcggcgg acttgggatt accgtcggaa tgcgcgacaa cgctctcacc       360
     gttatcgccc ctatcgaagg gacgcctgcc gataaagcgg gaatcaaagc aggcgatatt       420
     atccttaaaa tcaatgataa atcaacactg agcatgacga tagacgatgc cgtgagtatc       480
     atgcgcggtg ctccgaaaac cccgatcgat cttaccatcg tccgcaaagg gttggccgat       540
     cctcttaaaa tccatattat ccgagatatc atcaccgtcc aatccgtata cacccgaaat       600
     atcagcggaa atatcctcta tatccgtgtt accagtttcg ataaaaaagt tgcggcggat       660
     gtcaaaaaag cgattaaaaa atacagcgga aaaagcaaag ggattatcct cgatttgcga       720
     aacaatccgg gaggattgct cgatcaggcg gttgacctga ccgatctgtt tgtagacgag       780
     gggatcattg tctcccaaaa agggcgtaac aaagccgatg atatgacgta taaggcaacg       840
     aagagcaata cgataaccga tctcccgctt gtcgttttgg tgaatgaagg ctcagccagc       900
     gcatccgaaa tcgtcagcgg tgcacttcaa gacttgaaac gggcagtcat cgtcggagaa       960
     aaaaccttcg gaaaaggctc cgtccaagtg gtcatgccga ttacggaaac cgaagggatc      1020
     aaactcaccg ttgcacgcta ctatctccca agcggccgta ctattcaagc cgtcggcgtg      1080
     acgcctgaca tcgaagtcgc tgcaggtgaa ataaaaaaac atgagaagtc ttttaatatc      1140
     aaagaagccg atcttaaaga gcatctggtt tccgaacttg aaaaaagcga cggaatgatt      1200
     gacgttaccg aagccaatgc taccaataaa accgtaatta cccctgagca gatgaataga      1260
     gatattcagc tcaaagaggg tgtcgatatt atcaaagctt taatcatagt caaaggaaag      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page