(data stored in ACNUC7421 zone)

EMBL: CP002355.PE392

CP002355.PE392       Location/Qualifiers
FT   CDS_pept        complement(388365..388637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0393"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="COGs: COG0724 RNA-binding protein (RRM domain);
FT                   InterPro IPR000504; KEGG: nis:NIS_0278 RNA-binding protein
FT                   RNP-1; PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; SPTR: RNA-binding protein RNP-1;
FT                   PFAM: RNA recognition motif. (a.k.a. RRM, RBD, or RNP
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33060"
FT                   /db_xref="GOA:E4TZ61"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ61"
FT                   /protein_id="ADR33060.1"
FT                   /translation="MTQIYVGNIPYGKDENDLKDLFGQYGEVSSVKFVNDKETGRFRGF
FT                   GFVEMANKDEADKAITALEGNDFGGRTLRVNEARPRAPRPPRDRW"
     gtgacacaaa tttatgtcgg gaatattccc tacggcaaag acgaaaatga tcttaaagat        60
     cttttcggac aatacggtga agttagttca gttaaattcg taaatgataa agagacaggc       120
     cgtttccgcg gtttcggttt cgttgaaatg gcgaacaaag acgaagctga caaagcgatc       180
     actgcccttg aaggtaacga tttcggcggg cgtacacttc gtgttaacga agcgcgtcca       240
     cgtgctcctc gccctccacg cgatcgctgg taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page