(data stored in ACNUC7421 zone)

EMBL: CP002355.PE393

CP002355.PE393       Location/Qualifiers
FT   CDS_pept        complement(388778..390880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0394"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="COGs: COG5001 signal transduction protein containing
FT                   a membrane domain an EAL and a GGDEF domain;
FT                   InterProIPR000014: IPR000160: IPR013767: IPR013655: IPR
FT                   001633: IPR000215; KEGG: cyt:cce_2032 hypothetical protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold-3 domain protein; PAS fold domain protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein; SPTR: Diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(S); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain;
FT                   GGDEF domain; PAS fold; TIGRFAM: PAS domain S-box;
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33061"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ62"
FT                   /protein_id="ADR33061.1"
FT                   /translation="MQTEAPLYDVLNYLPDGIIMLDERGVILFANDAFSEMVGYKSDLL
FT                   LGLNMLSLLADITVFTECIAKVMKEGQSLDAETDFLHRDGHIVQAVKSVRMIRHNDHTR
FT                   FFVNVRNLTDLIQFNKELRASKELIELQAAELSFLLNSKHQEIEDILSSIDEVIWYIHN
FT                   QTLSLQYVNKAVETIFGFTKETFLSDTTLWQQQIHPEDRSLVQMFFETLAPGQSQEIRF
FT                   RILHCDGEVRWLNSRIHNHPKLNLFIGITSDITCSKAQSEEIAFLAYHDPLTHLPNRAK
FT                   LKLQLENRFEHAPNSPFALMFLDLDNFKNINDTMGHKIGDKILIEVSRRIRETVGKYDF
FT                   YARFGGDEFVILLQDADSASIDLTAQKLIQVFKEPCTLNETEFFLSASIGIVLYPDDAL
FT                   NGDDLIKHADTAMYEAKKKGKNQFAYYHTSMERAIHHFMYIESLIREGLTQNLFELYFQ
FT                   PLIDSKTLRMEGYEALLRLKHPHKGFIPPDTIIPVAEANGDIHLIGDKVLSQACDFIDA
FT                   LRALQDEPFFVAINVSAKQLQRNKFVQELFDYLALRSIPSSYLKVEVTESTVMENIAVV
FT                   SQQLSQLKAGGIRISLDDFGTGYSSFAYLAQLPIDTLKIDKSFILALFKDNSNRHIVEA
FT                   ISNLAHALGMNVTAEGVEEAQHYDFLLENNIDTLQGYHLCRPLPKDEILNNMQKILPVL
FT                   REYTRQ"
     atgcagacag aagccccgct ctatgatgtt ttaaactatc tccccgacgg gatcattatg        60
     cttgatgaac gaggtgttat tctttttgcc aacgacgctt tttctgaaat ggtaggctat       120
     aaaagcgacc tgttattagg gcttaatatg ctgagccttt tagcggatat tacagtcttt       180
     accgagtgta tagccaaagt aatgaaggag gggcagtccc tcgatgccga aaccgatttt       240
     ctccatcgcg acggacatat cgtccaagcg gtaaaaagcg ttcggatgat ccgtcataat       300
     gaccataccc gtttttttgt caatgtcaga aaccttaccg atcttattca gttcaacaaa       360
     gaactccggg cttccaaaga gcttatcgag ttacaggctg cggaactctc gtttctgctg       420
     aattccaaac atcaggaaat tgaagatatc ctcagcagta tcgatgaagt gatctggtat       480
     atccataacc aaacactttc gctgcaatat gtaaataaag ccgttgaaac aattttcggt       540
     tttacaaaag agactttttt atccgacacg accctctggc aacagcagat tcatcctgaa       600
     gatcgctccc tggttcaaat gttttttgaa acactcgccc ccggacaatc gcaggagata       660
     cggttccgta ttcttcattg cgacggtgaa gtacgatggc tcaacagccg gatccataat       720
     catccgaaac taaacctttt tatcggaatc acaagcgata ttacctgttc taaagcccaa       780
     agcgaagaga tcgctttttt agcctatcat gacccgctta cccatctgcc gaacagagca       840
     aaactcaaac tgcagttgga aaaccgtttc gaacacgctc cgaattcccc ctttgcgttg       900
     atgtttttag acttggataa ttttaaaaac atcaacgata cgatgggaca taaaatcggc       960
     gataaaattc tgatcgaagt gagccgccgt attcgtgaaa cggtagggaa atacgatttt      1020
     tatgcccgtt tcggaggaga tgaatttgtt attttgctcc aagatgccga tagcgcgtcg      1080
     attgacctta ccgctcaaaa gctgattcag gtttttaaag agccctgtac gctaaacgag      1140
     accgaattct tcctctccgc ctccatcggt atcgtccttt atccggatga tgccctcaac      1200
     ggcgatgact tgatcaaaca cgctgatacc gcaatgtatg aagcgaaaaa gaaagggaaa      1260
     aaccaattcg cgtattacca cacttcgatg gagcgggcga ttcaccattt catgtacatt      1320
     gaatcgttga tacgcgaggg gctgacccaa aacctttttg agctctattt tcaaccgctg      1380
     atcgattcca agacactccg gatggaaggg tatgaagccc ttttacgact caagcatccg      1440
     cacaaagggt ttatccctcc ggacactatt atacctgtgg ccgaagcaaa cggggacatc      1500
     catcttatcg gggataaagt actttcccag gcctgcgatt ttatcgatgc tctgcgggct      1560
     ttgcaggacg aaccgttttt cgttgctatt aacgtttcgg caaagcagct tcaacgcaat      1620
     aaatttgttc aggaattatt cgattatctg gcccttcgtt caattccctc ttcctatcta      1680
     aaagtggaag tcacggaaag cactgttatg gaaaacattg ccgttgtcag tcagcagctt      1740
     tcacaactga aagccggcgg gatacggatt tcactggacg atttcggcac cggatactct      1800
     tcgtttgcct atttggcaca acttcccatt gataccctta aaatcgacaa gtccttcatt      1860
     ttagccctct tcaaagacaa ctccaaccgc catattgtcg aagcgatatc aaatctcgcc      1920
     catgccttag ggatgaatgt cacagctgag ggggtcgaag aggctcagca ttatgacttt      1980
     ttacttgaaa acaatatcga tacgcttcaa ggctaccatc tctgccgtcc tcttccgaaa      2040
     gatgaaatcc tcaacaatat gcaaaaaata ctccctgttt tgcgagaata cacgaggcag      2100
     tag                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page