(data stored in ACNUC7421 zone)

EMBL: CP002355.PE395

CP002355.PE395       Location/Qualifiers
FT   CDS_pept        392651..393484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1508 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ64"
FT                   /protein_id="ADR33063.1"
FT                   /translation="MDSYKNFVGLGVAGNFALHLEQAGESADFKDVVSEDPNGPKGVFP
FT                   FYIPGREGQLGVYPLSCDTIILPKEACNVQPEPEVALICELTYDAEGNVSAITPKFFGA
FT                   YNDCSLRKEGAAKISHKKNWGEGTKGLSRTLIPIDSFEQGGIMDRYRIASFVRREGMMM
FT                   RYGEDVELTGYSYFHGKLIEWLKNQLNTQEDFGPLEPIKNYLMEAGSPAQAIISIGATR
FT                   YTHFGETNFLQDGDEVIVVVYDNDKYCMNPILSMANRGALEGEGISALIQKVVRG"
     atggacagct ataagaactt tgtcggactc ggtgttgcgg gcaattttgc tctccatctc        60
     gaacaagcgg gcgagagtgc cgatttcaaa gatgtcgtga gcgaagaccc gaacggtccc       120
     aaaggggtgt tcccttttta tattcccgga cgtgaggggc agctcggtgt ctatccgctc       180
     agttgcgata cgatcatact tccgaaagag gcatgcaatg ttcagcccga acccgaagtg       240
     gctcttatct gtgagcttac gtacgatgcg gaaggcaacg tgagtgccat cactccgaaa       300
     tttttcggtg cctataacga ttgttccctc cgcaaagagg gagcggcgaa aataagccat       360
     aagaagaatt ggggtgaagg aaccaaaggg ctctctcgta cattgattcc gattgattcg       420
     tttgaacaag gcgggattat ggataggtat cgaatcgcct cgtttgttcg ccgtgaaggg       480
     atgatgatgc gctacggcga agacgtggag cttacaggct atagctattt tcacggaaaa       540
     cttatcgagt ggcttaaaaa tcaactcaac acacaagaag attttggccc cttggaacct       600
     atcaaaaact atctgatgga ggcgggatct cctgcgcagg cgatcatcag tatcggtgcg       660
     acccgctata cccatttcgg cgagaccaat tttctccaag acggagatga ggtcattgtc       720
     gtagtttacg ataatgacaa gtattgcatg aatccgatcc tctcgatggc caatcggggt       780
     gctttggaag gcgaggggat aagcgccctt atccagaagg tagtacgtgg ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page