(data stored in ACNUC7421 zone)

EMBL: CP002355.PE399

CP002355.PE399       Location/Qualifiers
FT   CDS_pept        395316..395630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO0669 ATP phosphoribosyltransferase
FT                   catalytic subunit; SPTR: ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33067"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZ68"
FT                   /protein_id="ADR33067.1"
FT                   /translation="MAKRLIKDERIKTIIHNIAEDFRFSHETGDYALLFYKADTEGAVR
FT                   GADIEAMIEYLSTGLSELQDNIQWRREFLSENPGVDEIRMLENLGVIEKEYIDLLEFLR
FT                   "
     atggcaaaac gactcataaa agatgagagg atcaagacga ttatacataa tattgccgaa        60
     gattttcgtt tttcacatga aacgggagac tatgcgctgt tgttttacaa agccgatacc       120
     gaaggtgcgg ttcggggcgc cgatatcgag gcgatgatcg aatatctctc gacaggactc       180
     tccgaacttc aggataacat tcaatggaga cgggagtttt tgagtgaaaa tccgggcgtt       240
     gatgagatcc ggatgttgga aaatctcggt gttatcgaaa aagagtatat cgatttgctg       300
     gagttcttac gttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page