(data stored in ACNUC7421 zone)

EMBL: CP002355.PE4

CP002355.PE4         Location/Qualifiers
FT   CDS_pept        5216..6619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0004"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR001633:
FT                   IPR000160; KEGG: nis:NIS_0004 hypothetical protein; PFAM:
FT                   EAL domain protein; GGDEF domain containing protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; SPTR:
FT                   Diguanylate cyclase/phosphodiesterase, putative; PFAM: EAL
FT                   domain; GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32672"
FT                   /db_xref="GOA:E4TW56"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW56"
FT                   /protein_id="ADR32672.1"
FT                   /translation="MTYTEQKEREHRFALALRMGLPIFFLSSVTLFALFSQTYTSLASL
FT                   IVLSISLLGIMIYFIFYLIYQSAHETITDPTTYAFTSEYFFKLGSKALLKNTQTVMMIS
FT                   VENLWSINERYGIKNGDKALQNTVKKLDRFFRDKGYDKLPIGRYKGGDFLAFLPGEKEQ
FT                   YRVLIELFLSKYENHIDNEIEIRVGIVMVDSRLSNNMELLTSRLYELHNDRLTAEKEEF
FT                   YSINELEHEILEALEHKRISIGFWPVCCDDDMFDTSVKLIDSEGRLIHQSRYIPVLNRL
FT                   NKMRFLESDVLEKIGALCNEKNQNIVLTISPVTLRNPHFFEHALTLFERYPKARNKITL
FT                   LFEEREYCHQLERFSQQIAHYRKAGYKIALDRLGGYQTTLLYLKELEIDIVRFDSLYSR
FT                   NIKKAGYQNIIQGLNLSAHLCGAKTWMSMIEDSNSDQLCQSLKINYRQGNYLGKILTLD
FT                   DITKKETNI"
     atgacctaca ccgaacaaaa agagagagag caccgctttg ccttggcatt gcggatggga        60
     ttgcctatct tttttttgag ttcggttacc ctttttgccc ttttctccca aacctatact       120
     tctctcgctt ctttaatcgt gttgtccata tcgctgctcg ggatcatgat ctattttatt       180
     ttttacctca tttatcaaag tgcccatgag acgattaccg atccgacgac ttatgcattt       240
     acctcagaat atttttttaa attaggctca aaagcgctcc tcaaaaatac gcaaaccgtc       300
     atgatgatca gcgttgagaa tttatggtct atcaatgagc gctacggtat taaaaacggg       360
     gataaagcgc tccaaaatac cgtaaaaaag ctggatcggt ttttccgaga caaagggtat       420
     gacaaacttc cgatagggcg ttataaaggg ggtgactttt tagccttttt gccgggagaa       480
     aaagagcagt atagagtatt gatcgagctg tttttgtcca aatacgaaaa tcacatcgat       540
     aatgagattg aaataagagt cgggatcgta atggtagatt cgcgcctctc gaataatatg       600
     gaacttttga caagccgttt gtatgaactt cataacgatc ggttaacagc agaaaaagag       660
     gaattttatt caatcaacga actcgaacat gaaatacttg aggcattgga acataaacgc       720
     atttcgatcg gattttggcc ggtatgctgc gatgatgaca tgtttgacac gtcggtgaaa       780
     ttaattgatt ccgaggggag gctgattcat caaagccgtt atattcccgt actcaaccga       840
     ctcaataaga tgcgttttct ggagagtgac gtacttgaaa aaataggggc attatgcaat       900
     gagaaaaatc aaaatatagt gttaactatc tctcccgtta cattgcggaa tccccatttt       960
     ttcgagcatg ctctcacttt attcgaacgt tatccgaaag cgcggaataa aataacattg      1020
     ttgtttgaag agagggagta ttgtcatcag ctagaacgtt tttcacagca aatagcccat      1080
     tatcgcaaag ccggatataa aatcgctctg gatcgtttgg gcggctatca gacaaccctt      1140
     ttatatctca aagagcttga gatagatatt gtccgtttcg attctcttta cagccgaaac      1200
     ataaaaaaag cggggtatca gaatattatt caggggctga atctcagtgc ccatctgtgc      1260
     ggtgcgaaaa catggatgtc gatgattgaa gactcaaata gcgaccagct ttgccaatcg      1320
     cttaaaatta attatcggca gggaaattat ctgggtaaaa ttttaacact ggacgacatt      1380
     actaaaaagg aaacaaatat atga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page