(data stored in ACNUC7421 zone)

EMBL: CP002355.PE40

CP002355.PE40        Location/Qualifiers
FT   CDS_pept        40230..41306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0040"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="COGs: COG0743 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; InterPro IPR003821: IPR013512: IPR013644;
FT                   KEGG: tdn:Suden_0126 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain-containing protein; PRIAM:
FT                   1-deoxy-D-xylulose-5-phosphate reductoisomerase; SPTR:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; TIGRFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase;
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal;
FT                   TIGRFAM: 1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32708"
FT                   /db_xref="GOA:E4TW92"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW92"
FT                   /protein_id="ADR32708.1"
FT                   /translation="MILLGSTGSIGVNALKIADQFNLSVDTLVAGRNITLLNDQIKRHN
FT                   PKRVVVMRQEDTHLVNHSNVRFGESAILDAIEESSSGHVVNALVGFAGFAPTLKALECG
FT                   KRVALANKESLVVGGAFVNTSNIVPIDSEHFGLWYLNQTGRSISRMMITASGGAFRDWP
FT                   LEKLSSATLQDALNHPNWSMGQKITIDSASMVNKLFELLEARWLFGEGEYDALIETKSL
FT                   IHALIDYTDGSTTAHFAHADMRLPIAYALMGKVETPIVNRIDLAQIGSLEFRPIDAARY
FT                   PIWEIKNDLLKNPARGVIVNAANEAAIERFISGEIRFVDISTMILNAYNRFSGMPESIE
FT                   AVFSLDEEIRRYVKGLSC"
     ttgatccttc tggggtccac cggttcgatc ggagtcaatg ctctaaagat tgcggatcag        60
     tttaatctgt cggtcgatac tcttgtcgcc gggcgtaata taactcttct caacgatcag       120
     attaaacgtc ataatcctaa acgtgtcgtt gtgatgcgcc aagaagacac ccatcttgta       180
     aaccacagta atgtccgctt tggcgagagc gcgatactcg acgcgattga ggaatcctca       240
     tcagggcacg ttgtcaatgc cctggtcgga tttgccggtt tcgctccgac gctcaaagcg       300
     ctagaatgcg ggaaacgggt tgctcttgcc aacaaagaat ccctcgttgt cggcggtgcg       360
     tttgtaaaca cttccaatat cgtccccatc gattcggaac atttcggatt gtggtatttg       420
     aatcagaccg ggcgctctat cagccgtatg atgatcaccg ccagcggagg agcgttccgc       480
     gactggccgt tggaaaaact ctcctccgcg acgcttcaag atgccctgaa ccaccccaac       540
     tggtctatgg ggcagaagat taccatcgac agcgcctcga tggtcaacaa gctctttgag       600
     cttttggaag ctcgttggct cttcggagag ggggaatacg atgccctcat cgagacaaag       660
     tctctgatcc atgcccttat cgattatacg gacggctcaa cgaccgccca ttttgcccac       720
     gccgatatgc gtcttcccat tgcgtatgcg ctgatgggaa aagttgaaac ccctattgtt       780
     aatcgaatcg atttagctca aatcggttcg ctggaatttc gccctatcga tgcggcacgc       840
     tatccgattt gggaaatcaa aaatgacctg ttgaaaaatc ccgcccgcgg cgtcatcgtc       900
     aatgcggcaa acgaagcggc tattgagagg tttatctccg gagagatccg ttttgtcgat       960
     atttccacta tgattctcaa tgcgtataac cgatttagcg gcatgcctga gtctatcgaa      1020
     gccgttttct ccctggatga ggaaattcgc cgttacgtca aaggtttgtc gtgctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page