(data stored in ACNUC7421 zone)

EMBL: CP002355.PE400

CP002355.PE400       Location/Qualifiers
FT   CDS_pept        complement(395730..396131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0401"
FT                   /product="rhodanese-like domain-containing protein"
FT                   /note="InterPro IPR001763; KEGG: tdn:Suden_1498
FT                   rhodanese-like domain-containing protein; SPTR:
FT                   Rhodanese-like domain protein; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33068"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI0"
FT                   /protein_id="ADR33068.1"
FT                   /translation="MRILLIALLLSATALMADYSHQPIDQKLIDSKIKIIDIRTPNEWK
FT                   TTGVVKGSLPIMFFDENGNYDMNGFLAELNTKVKKNERFALICNSGNRSKVLGTYLGKQ
FT                   LGYNVIDLDGGIQYAIAKKMPLEPYQPKK"
     atgcgaattt tgcttattgc cctattgtta tccgctaccg ctttgatggc cgattatagt        60
     catcagccga tcgatcaaaa gctgatcgat tccaaaatca aaatcatcga tatccgcact       120
     ccaaatgaat ggaaaacaac cggagtagta aaaggctcgc ttccgatcat gttttttgat       180
     gaaaacggga attacgacat gaacggtttt ttagcggaac tgaacacaaa agtcaaaaaa       240
     aatgaacgct tcgcactcat ctgtaacagc ggcaaccgca gcaaagtact cggtacctat       300
     ctgggcaaac agcttggcta taacgttatc gatttagacg ggggaatcca gtacgccatc       360
     gctaaaaaaa tgcctcttga gccttatcaa ccgaaaaagt aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page