(data stored in ACNUC7421 zone)

EMBL: CP002355.PE401

CP002355.PE401       Location/Qualifiers
FT   CDS_pept        396194..396556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1497 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33069"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI1"
FT                   /protein_id="ADR33069.1"
FT                   /translation="MNASKEENSKRLRYIRLLGRFISGIISWLSKAQSPTKEQYDQKVD
FT                   MNFRFLEKNEAVKLYKDEYTELEALGQKILDFRASENDIETIKEELFYAQNQLEKRINA
FT                   RRYKKSKHDNHTTDGW"
     atgaacgcat ctaaagagga aaattcaaaa cggcttcgct atatccgttt gctcggccgc        60
     tttatcagcg ggattatctc gtggctttca aaagcgcaga gcccgacaaa agagcagtat       120
     gatcaaaaag tggatatgaa tttccgtttt ttggaaaaaa acgaagcggt gaaactctat       180
     aaagacgaat acaccgaact cgaagctttg gggcaaaaaa tccttgattt cagggcaagc       240
     gagaatgata tcgagacgat caaagaggag ctgttttacg cccaaaatca gcttgaaaaa       300
     cggatcaatg cccgccgata caaaaaatca aaacatgata atcacacaac ggacggatgg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page