(data stored in ACNUC7421 zone)

EMBL: CP002355.PE402

CP002355.PE402       Location/Qualifiers
FT   CDS_pept        complement(396557..397114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0403"
FT                   /product="protein of unknown function DUF204"
FT                   /note="COGs: COG1971 membrane protein; InterPro IPR003810;
FT                   KEGG: ccv:CCV52592_0090 membrane protein; PFAM: protein of
FT                   unknown function DUF204; SPTR: Putative membrane protein;
FT                   PFAM: Domain of unknown function DUF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33070"
FT                   /db_xref="GOA:E4TZI2"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI2"
FT                   /protein_id="ADR33070.1"
FT                   /translation="MNETLLILAVALAMDSVAVSIAIGSKYKRLLLSKVLFVAAVFGFF
FT                   QGIMPLAGYFIGISFAQYVQDYDHWIAFALLTALGGKMLYEAYKNEFDEEVTDLSTKTL
FT                   ITLGIATSIDAMAIGVTFAFLQTDIYTAAGVIALVTFLLCIAAVYIGKKLGSLLESKAE
FT                   MLGGLILIGLGFKILLEHLGVI"
     atgaacgaaa ctcttcttat cctcgccgta gcattggcga tggattccgt agccgtatcg        60
     attgccatcg gttcaaagta caaaagactg ctcctctcta aagtgctttt cgttgccgcc       120
     gtttttggat tttttcaggg aattatgcct ttggcaggat attttatcgg aatcagtttt       180
     gcgcaatacg tccaagacta tgatcactgg atcgcttttg cactcctcac ggcactcggg       240
     gggaaaatgc tctacgaagc ctacaaaaac gaatttgacg aagaggtcac cgatctttca       300
     accaagacac ttatcactct agggattgct acaagtatcg atgccatggc gatcggtgtg       360
     acgtttgcct ttttgcaaac cgatatttat accgcagcgg gcgtcatcgc tttggtcaca       420
     ttcctattgt gtatagcggc ggtgtatatc gggaaaaaac tgggatcgct tctggaaagc       480
     aaagcggaga tgctcggcgg gttaatttta atcggattag gctttaaaat cttattagag       540
     catttaggag taatttaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page