(data stored in ACNUC7421 zone)

EMBL: CP002355.PE403

CP002355.PE403       Location/Qualifiers
FT   CDS_pept        complement(397190..398254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0404"
FT                   /product="permease"
FT                   /note="COGs: COG0701 permease; InterPro IPR005524; KEGG:
FT                   nis:NIS_0906 hypothetical protein; PFAM: permease; SPTR:
FT                   Putative uncharacterized protein; PFAM: Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33071"
FT                   /db_xref="GOA:E4TZI3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI3"
FT                   /protein_id="ADR33071.1"
FT                   /translation="MNLIWEAFWDLSVAMGIYILFGLLAAGVLHQLIREEWIQKHLGSD
FT                   THGSVYKAALFGTPLPLCSCSVIPFAASLRRNGASKGATLSFLISTPITGIDSILATFG
FT                   MFGWVFTFYRVFTSVILAITAGMLMNIFDPKEVAKKGVAFSATPPNAPSPIIQSAKEEK
FT                   KPPFSVSGVFQYGLVTLLGSFSKPLLFGLLLGAFITAAIPSNLQELFNDNRILGYLLAV
FT                   AIAAPMYVCATESLPIAASLIIAGVSPGAAFIFLSAGPATNTVTMGAVKSMLGTRALVI
FT                   YLSVIAIGSITFGALVDIVFDTLSINMGINLHEHRGIVEEAAAVLMLGLIGWHLIRGLF
FT                   QQKEKGCNGGSCCS"
     gtgaatttga tttgggaagc attttgggac ttaagtgttg ctatgggcat ttatatcctt        60
     tttggtttat tggccgcagg ggtactgcat cagctgatcc gtgaagagtg gatccaaaaa       120
     catttgggtt ccgacacgca cggatcggtc tataaagcag ctctgttcgg aacacctctc       180
     cccttgtgct cctgcagtgt catccctttt gcggcatcac tgcgacgtaa cggcgcttcc       240
     aaaggcgcta cgctgtcttt tttgatctcg actccaatca cgggaatcga ttcgatactt       300
     gcaaccttcg ggatgttcgg atgggtattt actttttacc gtgttttcac ctcggttatc       360
     ctagcgatta ctgccggaat gctgatgaat atctttgacc ccaaagaagt tgccaaaaaa       420
     ggggttgctt tttcggcaac ccctccgaat gctccttctc ccattatcca atcggctaaa       480
     gaagaaaaga aaccgccgtt ttcggtctcg ggcgtttttc agtacggtct ggtaacactt       540
     ctgggaagct ttagcaagcc cctcttattt gggctattgc tcggtgcctt tatcacagcg       600
     gcaatcccct ccaatcttca ggaactcttt aatgacaacc gtattttagg ctacctgctg       660
     gccgttgcga tcgccgcacc catgtatgta tgcgctaccg aatcacttcc gatagccgct       720
     tcactcatca tagccggagt ttctccggga gccgcattta tcttcctcag tgcaggaccg       780
     gcaaccaaca ccgtaacgat gggggcagtt aaatcgatgc tcggaacgcg tgcattggtg       840
     atttatctct ccgtcattgc catcggaagt attacattcg gtgcattagt cgatattgta       900
     tttgacaccc tctcaattaa catgggtata aacctgcatg aacaccgcgg aatagtcgaa       960
     gaagctgctg cagtgctcat gcttgggctt atcggatggc acctcatccg tggattattt      1020
     caacaaaaag aaaaggggtg taacggcggt tcatgctgct cctaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page