(data stored in ACNUC7421 zone)

EMBL: CP002355.PE404

CP002355.PE404       Location/Qualifiers
FT   CDS_pept        complement(398348..399274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0405"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="COGs: COG1230 Co/Zn/Cd efflux system component;
FT                   InterPro IPR002524; KEGG: net:Neut_0043 cation diffusion
FT                   facilitator family transporter; PFAM: cation efflux
FT                   protein; SPTR: Probable metal transporter; TIGRFAM: cation
FT                   diffusion facilitator family transporter; PFAM: Cation
FT                   efflux family; TIGRFAM: cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33072"
FT                   /db_xref="GOA:E4TZI4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI4"
FT                   /protein_id="ADR33072.1"
FT                   /translation="MSTSAEKWYHSHIFDEGNPLAERNTRIAVALTAFMMVAEIIGGWA
FT                   YNSMALLADGWHMGTHALALGLSVMAYGAARRYENDKRFAFGTWKIEVLGGYTSAIFLV
FT                   GVAALMFYESAQRLISPTPIHYGEAIQIAVIGLVVNLICAWLLKDGHHHDHDHHHGHDH
FT                   SHDHHHDLNLRSAYMHVIADAATSVLAIIALFCGMLWGAAWLDPIMGIVGAGLVAVWAY
FT                   GLLRDSGRILLDAEMDAPVVDEIYDVIEASPIKATITDLHVWRVGKGKYSCILSLHTTE
FT                   EVSPDFFKQQLSIHEELVHITVEVNQA"
     atgagcactt ctgccgaaaa atggtatcac tctcacatct ttgacgaagg caatcccctt        60
     gctgagcgaa acacccgtat agccgtcgcg ctaaccgctt ttatgatggt agccgagatc       120
     atcggcggat gggcttataa ctctatggcc cttctggctg acggctggca catgggaacc       180
     catgcattgg cactcggatt atcggtgatg gcctacggtg ccgcacgtcg atatgaaaat       240
     gacaagcgtt ttgcattcgg tacatggaaa atagaagttc tgggaggtta taccagtgcc       300
     attttccttg tcggcgtggc tgcacttatg ttctatgaat cagcgcagag gcttatttca       360
     ccgacgccga tccattacgg cgaagcgatc caaatcgccg tcatcggttt ggtagtcaat       420
     ctgatatgcg catggcttct taaagacggg caccatcatg atcatgatca ccaccacggc       480
     cacgatcata gtcatgatca tcatcacgat ttgaatctcc gctcagccta tatgcacgtt       540
     attgcagacg ccgctacttc ggttcttgcc attatcgcac tcttctgcgg gatgttatgg       600
     ggtgctgcct ggctcgatcc gatcatgggg atcgtgggag ccggtttggt tgcggtttgg       660
     gcatacgggc tgctgcgcga ctcgggacgc attttgctcg atgccgaaat ggatgcgccc       720
     gtggtggatg aaatctatga cgtcattgaa gcaagcccta tcaaagcaac cattaccgat       780
     ttgcatgtat ggcgtgtcgg aaaagggaaa tactcctgta tcctctcatt gcatacgacc       840
     gaagaggttt cccccgattt tttcaaacaa cagctgagca ttcatgagga gctggttcac       900
     attacggtgg aagtgaacca agcataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page