(data stored in ACNUC7421 zone)

EMBL: CP002355.PE405

CP002355.PE405       Location/Qualifiers
FT   CDS_pept        399351..399623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0406"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein;
FT                   InterPro IPR003735; KEGG: pag:PLES_38841 hypothetical
FT                   protein; PFAM: protein of unknown function DUF156; SPTR:
FT                   Protein of hypothetical function DUF156; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33073"
FT                   /db_xref="GOA:E4TZI5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI5"
FT                   /protein_id="ADR33073.1"
FT                   /translation="MAHTIHSKKQLLTRVRRIKGQAEALERALDDEKECSAVLQQIAAI
FT                   RGAINGLMSEVMEGYIREHLSPDVPEQQRNEDLEKLVSVIRSYLK"
     atggcgcata cgatccattc taagaaacag ttattgacac gggtccggcg gataaaaggg        60
     caggcagaag cattggagag ggcattggac gatgaaaaag agtgctcggc ggtgcttcag       120
     cagattgccg cgattcgagg ggcaatcaac ggtttgatga gtgaggttat ggaaggatat       180
     atacgcgagc atctcagccc ggatgttccg gaacagcagc gcaatgaaga cttggaaaag       240
     ctggtgagcg tgattcgctc gtatttaaaa taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page