(data stored in ACNUC7421 zone)

EMBL: CP002355.PE406

CP002355.PE406       Location/Qualifiers
FT   CDS_pept        complement(399633..399818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33074"
FT                   /db_xref="GOA:E4TZI6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI6"
FT                   /protein_id="ADR33074.1"
FT                   /translation="MCLIITFAFIVATFSFFSQGLIPHAIISGLLASVSLFFFIRKLIF
FT                   NGRCIFGKDTDCNTPK"
     atgtgtctta taataacgtt tgcttttatc gtagcgacct tctctttttt ttctcagggg        60
     cttataccgc atgcaattat cagcggtctt ctcgcctccg tttccctttt cttttttatc       120
     cgtaaactca tttttaacgg acgttgcata ttcggtaaag ataccgattg caataccccg       180
     aaataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page