(data stored in ACNUC7421 zone)

EMBL: CP002355.PE408

CP002355.PE408       Location/Qualifiers
FT   CDS_pept        400772..402745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0409"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR000160:
FT                   IPR003660: IPR001633; KEGG: cbe:Cbei_2527 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; histidine kinase HAMP region
FT                   domain protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; SPTR: Ggdef family protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain; GGDEF domain;
FT                   TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33076"
FT                   /db_xref="GOA:E4TZI8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI8"
FT                   /protein_id="ADR33076.1"
FT                   /translation="MSHKTTYTKIAAKIIFITMLVTLVATYIYGEYMKRDAITNLAHVD
FT                   AKKTSMLVFEALYSAMQRGWNKNDLEEIISRLNRVDSHMKVNVYRSEVVADLFGEIEKD
FT                   KVARESNTEIKKAIRGEEVLNISDKELIEYYYPVIAKENCLKCHVNASSGDVLGVIDIS
FT                   YPVENLKVPLTDMINFFIIFIIVFSIIVYLSIFIELNQYLIKPIKNFSNLIKNITASQD
FT                   MRKRIELNENIEEIDSIKDVFNSMLDSIEHQFYFDTLTGLENRRRLTEKLEERHSVFLM
FT                   IINIDSFQEINDLYGEPAGDLILKEFAQYLKEIMPKEEGLYRLHSDEFAHICTSGMDLN
FT                   EFRNFAALISEKISQKSFNIDERSEVSLSATIGVSYGSELLLVNADIALKLAKKTKKNF
FT                   LIYDNTMAMTKEYEKNFDWTKRLKKAIEEDKIVPLFQPIVDTKTQVIVKYEALMRMVDD
FT                   QGFYIAPVHFLELAKKNKLYHQLTKIMIQKTFEKFQSLTYFVSINISVEDILNKEINHF
FT                   IVKTLEESGIGHQIVFEIIESEGIENFDQVLEFINEVKQYGAKISIDDFGTGYSNFEYL
FT                   MKLKVDYIKIDGSMIKNIDSDKNSQMITTSIVSFAKNMNIKTVAEFVHSKNVFEKINEL
FT                   GVDYSQGYYFGEPTELVTPSSP"
     gtgtcccata aaacgactta tacgaagatt gcggctaaaa tcatttttat aacgatgtta        60
     gtcacgcttg tcgctaccta tatctatggc gagtacatga aaagagacgc aattacgaat       120
     ctggcgcatg tcgatgccaa gaaaacgagt atgctggttt tcgaagcact ctattccgct       180
     atgcaaagag ggtggaataa aaacgatctc gaagagatta tcagcaggct taaccgagtc       240
     gattctcata tgaaagtcaa tgtataccgg agtgaagtcg tcgccgatct tttcggtgaa       300
     attgaaaaag acaaagttgc ccgtgaatca aatacagaga tcaaaaaagc gattcgcggt       360
     gaagaagtac tgaatatttc ggataaagaa ctcatcgaat actactatcc cgttatcgcc       420
     aaagagaatt gtttaaaatg ccacgtaaat gccagttccg gagatgttct cggggtcatc       480
     gatatctcgt atcccgttga gaatttaaaa gtaccgctca ccgatatgat caactttttt       540
     attattttca ttattgtttt ttccataatt gtttacttgt ccatatttat agaactcaac       600
     cagtatttga tcaagccgat taagaatttt tctaatttga tcaagaatat aacggcgtct       660
     caggatatga gaaagcgcat agagctgaat gagaatatcg aagagatcga ttcgattaag       720
     gatgtcttta atagtatgct cgattcgatt gagcatcagt tttatttcga tacactgacc       780
     ggattggaga atcgaagaag gctcaccgaa aagttggaag agcggcacag tgtctttttg       840
     atgattatca acattgactc ttttcaagag attaatgatc tttacggaga gccggcgggg       900
     gatttgatac ttaaagagtt tgcccagtat ttaaaagaga taatgcccaa agaagagggg       960
     ttgtaccggc tccattcgga tgagtttgcc catatctgca ccagtgggat ggatttgaat      1020
     gagtttagga attttgccgc acttatcagt gagaaaatat cgcaaaagag ttttaacatc      1080
     gatgagcgga gcgaagtgag tctcagtgcg actatcgggg tatcgtacgg ttcggagctg      1140
     ctgctggtga atgcggatat cgcactgaaa ctggcaaaga aaaccaaaaa gaactttttg      1200
     atttatgata atacgatggc gatgacaaaa gagtatgaga aaaattttga ctggacgaag      1260
     cggctcaaaa aagcgatcga agaggataaa atcgttccgc tgtttcagcc gatcgtcgat      1320
     actaaaacgc aggtaatcgt taaatacgaa gcattgatgc ggatggtgga tgatcaagga      1380
     ttctacatcg ctcccgtcca ttttttagag cttgccaaga aaaataagct ctatcatcag      1440
     ttgacaaaaa tcatgattca aaaaacgttt gaaaaattcc agagcctgac ctatttcgtc      1500
     tcgatcaata tatcggtgga agatatttta aacaaagaga taaaccactt tatcgtaaaa      1560
     acgttggaag agtccggaat cgggcatcaa atcgtatttg aaatcattga atcagagggg      1620
     attgaaaatt tcgatcaggt tttagagttt atcaatgaag tcaaacaata cggggctaaa      1680
     atctcgatcg acgatttcgg aacggggtat tcaaatttcg agtatcttat gaagctgaag      1740
     gtcgattaca tcaaaattga cggttcgatg attaaaaaca tcgacagcga taaaaactcc      1800
     cagatgatta cgacatcgat tgtcagtttc gccaaaaata tgaatattaa aacggtggcg      1860
     gaatttgtcc attccaaaaa cgtttttgaa aaaataaacg aattgggagt ggactattcc      1920
     caggggtatt atttcggaga accgaccgaa ttggttactc cgtcttctcc ttga            1974
//

If you have problems or comments...

PBIL Back to PBIL home page