(data stored in ACNUC7421 zone)

EMBL: CP002355.PE409

CP002355.PE409       Location/Qualifiers
FT   CDS_pept        complement(402726..402881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_2099 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33077"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZI9"
FT                   /protein_id="ADR33077.1"
FT                   /translation="MKYILLIATVLTVFSGCSATWSGVKEDTSKAADWTKEKVNQGAAY
FT                   VKEKTE"
     atgaaataca tactgcttat agctactgtt ttaacggtat tttccggttg ctccgccaca        60
     tggagcggag ttaaagagga tacgtccaaa gcggctgatt ggacgaaaga aaaagtgaat       120
     cagggggctg cttacgtcaa ggagaagacg gagtaa                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page