(data stored in ACNUC7421 zone)

EMBL: CP002355.PE41

CP002355.PE41        Location/Qualifiers
FT   CDS_pept        41300..41830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0041"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="COGs: COG3545 esterase of the alpha/beta hydrolase
FT                   fold; InterPro IPR010662; KEGG: tdn:Suden_0144 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1234; SPTR:
FT                   Putative uncharacterized protein; PFAM: Alpha/Beta
FT                   hydrolase family of unknown function (DUF1234)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32709"
FT                   /db_xref="GOA:E4TW93"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW93"
FT                   /protein_id="ADR32709.1"
FT                   /translation="MLKVLILHGWGGSDDPHWQAWLAGEIAKDYGTVSFPLLDNPHFPS
FT                   KNRWMKQIKSLLNDFRPDIVICHSLANIAWFHLCNEGEISPVKRLLLVAPPHLTCEIET
FT                   LKTFFPLEAPKALFAEEVLLVTSTDDPYMSTQEAAELQKALGVEMKVIENGGHINTASG
FT                   YGEWPWVKEWVLQ"
     gtgctgaaag ttcttatact tcacggctgg ggaggaagtg atgatcccca ttggcaggca        60
     tggcttgcgg gtgaaatcgc caaagactac ggcaccgtct cttttcctct tttagacaat       120
     ccccattttc ccagtaaaaa ccgatggatg aaacagataa aatccctttt aaatgatttc       180
     cgccccgata tcgtaatctg tcactctttg gccaatatcg catggttcca tctgtgcaat       240
     gagggggaga tatcccccgt aaaacgcctc ttgctggtcg ctcctccgca tctgacctgc       300
     gagatcgaaa ccctaaaaac ctttttcccg cttgaagcgc caaaggctct ttttgccgaa       360
     gaggttttat tggttacctc gaccgatgat ccttatatga gtacacaaga ggctgctgag       420
     cttcaaaaag cgcttggtgt ggaaatgaaa gtgattgaaa acggcggaca tatcaatact       480
     gcctccggat acggagaatg gccgtgggtc aaagagtggg tactgcaatg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page