(data stored in ACNUC7421 zone)

EMBL: CP002355.PE411

CP002355.PE411       Location/Qualifiers
FT   CDS_pept        complement(403355..404803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0412"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: pin:Ping_1880 diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   SPTR: Diguanylate cyclase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33079"
FT                   /db_xref="GOA:E4TZJ1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ1"
FT                   /protein_id="ADR33079.1"
FT                   /translation="MKFKNNLYIVVTISVMMIVLSISISLINFMVSLRSTETDLKTRSL
FT                   PLTVDNIYTEIQKHVIEPNLVASMMAHDTFLKDWLIKDEQNSDKITRYLDTIKNKYGMF
FT                   VAFLVSEKTQSYYTQNGFLEHLSPTKSDNEWYYKFKTLQEDHEINLDFNNNLDNSLIMF
FT                   INHKIYDSDYHFVGATGIGLKISYINDMLKRFRQEYNFTVLFVNEEGKIILSERTDAKI
FT                   KSLYDAPELRNLADQIIIKDSKILEYQKDGVNYLLKTKYIPELDLYLLVEAKLDDFTQN
FT                   VRRTFYLNLAASLLVTVIITFIIIMMIRGYNEKLEFMARNDALTGLMNRHAFDDSFNDF
FT                   LLLSQRNNDPLSLIFFDIDNFKTINDTLGHQAGDNVLIRISELLKTRLRRTDIIGRWGG
FT                   EEFIIGLINTDYKNAEVIAETLRKAIEEDSRLIHLAPFPVTASFGVATVRTGDTIETIL
FT                   TRADSAMYRAKELGKNRIETELGT"
     atgaaattca aaaataattt atacatcgtc gtcaccatat cagtcatgat gatcgtcctc        60
     tcgatcagta tctctctcat caattttatg gtttcgctcc gctccaccga aaccgatcta       120
     aaaacccgtt cccttccgct gacggtggac aatatctaca cagaaattca aaaacacgtt       180
     atcgaaccga acctcgtcgc atcgatgatg gcacacgaca cgtttctcaa agactggctt       240
     atcaaggatg aacaaaacag cgataaaatc acccgttacc tcgatacgat caaaaacaaa       300
     tacgggatgt tcgtcgcctt tttggtttct gagaaaaccc aaagctatta cacccaaaac       360
     ggttttctcg aacatctcag ccctaccaaa tccgataatg agtggtatta taaattcaag       420
     acactccaag aagatcatga gatcaatctc gatttcaata ataacctcga taattcgctg       480
     attatgttta tcaaccataa aatctacgac agcgattatc attttgtcgg ggccaccggg       540
     atcggtttga aaatatcata catcaacgat atgctcaaac ggttccggca agagtacaat       600
     tttacggttc tgttcgtgaa cgaagagggg aaaattattt tatccgaacg gacagacgct       660
     aaaatcaaaa gcctttacga tgcccctgag cttcgcaatc ttgcggatca gatcattatc       720
     aaagattcca aaatcctcga atatcaaaaa gacggcgtaa attatctcct caaaaccaaa       780
     tatatccccg aactcgacct ctacctcctg gtcgaggcaa agttggatga ttttacccaa       840
     aacgtacgcc gaacgtttta tctgaacctc gccgcttcgc tgctggtaac cgtaatcatt       900
     acattcatca tcattatgat gatccgagga tacaatgaaa agctcgagtt tatggctcgc       960
     aacgatgctc taacagggct gatgaataga catgctttcg atgattcttt caatgatttt      1020
     ctccttctct cgcaacgaaa caatgatcct ctcagcctta tctttttcga tatcgacaac      1080
     tttaaaacta tcaacgatac gctcggccat caggcgggag acaacgtgct tatccgaatc      1140
     tctgagctcc tcaaaacccg tctgcgccgt accgacatca tcggacgttg gggaggtgaa      1200
     gaatttatca tcgggttgat taataccgat tataaaaatg ccgaagtcat tgccgaaacc      1260
     ctgcgcaaag caatcgaaga agactcccgt ctcattcacc tcgcaccgtt tcctgtaacc      1320
     gcaagctttg gggttgccac tgtacgcacc ggcgatacga tagagactat cctgacgcga      1380
     gccgattcgg ctatgtaccg tgcgaaagag ctcgggaaaa accggattga aacagagttg      1440
     ggaacgtaa                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page