(data stored in ACNUC7421 zone)

EMBL: CP002355.PE412

CP002355.PE412       Location/Qualifiers
FT   CDS_pept        complement(404822..405304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1827 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33080"
FT                   /db_xref="GOA:E4TZJ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ2"
FT                   /protein_id="ADR33080.1"
FT                   /translation="MIIPLSSETLSDFFTFFDFTCESDALQAFIGLLRETASHHQNIIH
FT                   AGYADQTPFGFVSLKITNDVDNIPGLLIEFLYIKPEYRQKMLGGTPRYSFSMLDDVIML
FT                   AFELQKIVAINHIFLIPVDENKRAMYLEYGFENIPGSGKNPFEDFMVFNLLSEEII"
     gtgattatcc ctctttcatc cgaaacatta tccgattttt ttacattttt tgatttcact        60
     tgcgaatccg acgcactgca agcatttatc ggtttactcc gcgaaacggc ttcacaccat       120
     caaaatatca tccatgcggg ctatgccgat caaacaccct tcggattcgt ctctcttaaa       180
     attaccaacg acgtcgataa tatccctgga ttattgatcg agtttttgta tattaagccc       240
     gagtatcggc aaaaaatgct cggaggcact ccacgataca gtttctcaat gctcgatgat       300
     gttattatgt tagcgtttga attacaaaaa atcgtggcga tcaaccatat ttttctcatc       360
     cccgtcgatg aaaacaaacg cgccatgtat ctcgaatacg gatttgaaaa catcccagga       420
     tcgggaaaga accctttcga agattttatg gtgtttaatc tgctttcgga agaaataata       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page