(data stored in ACNUC7421 zone)

EMBL: CP002355.PE414

CP002355.PE414       Location/Qualifiers
FT   CDS_pept        405885..406277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0692 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function, DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33082"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ4"
FT                   /protein_id="ADR33082.1"
FT                   /translation="MKKLLILICMMVLNLSAHSIHNDDQFKAAVASMGADNKLVLMIYT
FT                   TDDCPECAYMKQKVFHDKGVEDYMNRHFVVIEKNVHKNKLPDGYDFFGIPTMFFIDKAG
FT                   NRKETVVGSKRAQPFLAELHRIRGMK"
     atgaaaaaac ttttaattct tatttgtatg atggttttga acctttcagc ccattctatt        60
     cacaatgacg atcagtttaa agctgccgtc gcgtcgatgg gtgcggataa taaattagta       120
     ttaatgattt atacaacgga tgattgtccc gaatgtgcgt atatgaaaca aaaagtattt       180
     cacgataaag gggttgaaga ctatatgaac cgccattttg tagtgataga aaaaaatgtc       240
     cataagaaca aactcccgga cgggtatgat tttttcggaa taccgacgat gttttttatc       300
     gacaaagcgg gaaatagaaa agagacggtg gtcggaagca aaagggctca gccgtttttg       360
     gcagaactgc accgtatccg gggaatgaaa tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page