(data stored in ACNUC7421 zone)

EMBL: CP002355.PE415

CP002355.PE415       Location/Qualifiers
FT   CDS_pept        406274..406870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0416"
FT                   /product="pentapeptide repeat protein"
FT                   /note="COGs: COG1357 Uncharacterized low-complexity
FT                   protein; InterPro IPR001646; KEGG: tbd:Tbd_0916
FT                   hypothetical protein; PFAM: pentapeptide repeat protein;
FT                   SPTR: Pentapeptide repeat protein; PFAM: Pentapeptide
FT                   repeats (8 copies)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33083"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ5"
FT                   /protein_id="ADR33083.1"
FT                   /translation="MKLAWLAFWIGVSLSAYDAAHLKKALEDKECIGCDLRGADLSQND
FT                   FSGGDFHGSDLSEADLHESIFEMGDLSDCNLSGANAENALFWKGTMERADLTRIHARGA
FT                   NFKGVHLNRSRLNSADLRGTKSWKADFTDASFSKTDFTDAELGDAKFIRNDLRTVKMKR
FT                   ALLWQTRFSDTVLTKAQCAHAKKEEAILDANVTCR"
     atgaaattgg catggttggc tttttggatc ggtgtttcgt tgagcgcgta cgatgcggct        60
     catttgaaaa aagcgttgga agataaagag tgtatcggat gtgatttgcg gggtgccgat       120
     ctcagccaaa acgattttag cggcggcgat tttcacggca gcgatctcag cgaggccgat       180
     ttgcatgaga gtatttttga aatgggggac ttgagtgatt gcaatctcag cggagcaaat       240
     gccgaaaatg cccttttttg gaaagggacg atggagagag ccgatcttac ccgtatacat       300
     gcacgagggg ctaattttaa aggggtacat ctgaatcgaa gccgtttgaa ttcggctgat       360
     cttcggggga ctaaaagttg gaaagccgat tttaccgatg catctttctc aaaaacggat       420
     tttaccgatg cggagctggg ggatgcgaaa tttatccgaa acgatctgcg tacggtcaaa       480
     atgaaacgtg ccttgttatg gcagacccgt tttagtgata ccgttttaac caaagctcaa       540
     tgtgctcatg ctaaaaaaga agaggcgatt ttggatgcaa acgtgacgtg ccgttaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page