(data stored in ACNUC7421 zone)

EMBL: CP002355.PE416

CP002355.PE416       Location/Qualifiers
FT   CDS_pept        complement(406867..408015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0417"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="COGs: COG2059 Chromate transport protein ChrA;
FT                   InterPro IPR014047: IPR003370; KEGG: vsa:VSAL_I0672
FT                   putative chromate transporter; PFAM: Chromate transporter;
FT                   SPTR: Chromate transport protein; TIGRFAM: chromate
FT                   transporter, chromate ion transporter (CHR) family; PFAM:
FT                   Chromate transporter; TIGRFAM: chromate transporter,
FT                   chromate ion transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33084"
FT                   /db_xref="GOA:E4TZJ6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ6"
FT                   /protein_id="ADR33084.1"
FT                   /translation="MKIWELFWRFLLLGLVSFGGPAAHIGYFRTTFVDKLRWLDNASYA
FT                   RLVALSQFLPGPGSSQVGFAIGIERAGLLGGIAAFIGFTIPSFIFMATLAIVPFEPTPI
FT                   FTGMIHGLKLFAVIVVADAVLSMYRSFCTSTAASAIAIASAASLWLFPSLSTQMILLII
FT                   SAVIGLMFLHIPIATSAVPIRISYIPLILFLALFILVPFFVDVSKWIALFNTFFQSGAL
FT                   VFGGGHVVLPLLQHALGDSITTERFLFGYAAAQAVPGPMFSLAAFLGTDLSPSSPLLGA
FT                   LVATLSIFLPGFLLLLGLYRGWEILAQRPRIAAVAAGLNAAVVGILLAALYNPVFTSGV
FT                   TSTIDMALVVTGFFLLRMLKIPVVGLLPIFALSGVIISVKFV"
     atgaaaatat gggagctatt ttggcgattt ttactcttgg gactggtcag tttcggaggg        60
     cctgcagctc atatcggcta ttttcgtacc acttttgtcg ataaacttcg ttggctagat       120
     aatgcttctt atgctcgcct tgtcgcactc agccagtttc tcccaggccc cggatcgagt       180
     caagtaggct ttgcaatcgg gatagaacga gcaggactgc tcggcggaat cgcggcattt       240
     atcggcttta ccatcccctc gtttatcttt atggctactc ttgccatcgt cccctttgaa       300
     ccgactccga tttttacggg gatgattcat ggtctcaagc tttttgccgt gatcgtcgtc       360
     gccgatgcgg ttctttcgat gtaccgctcg ttttgcacct ctaccgcagc ttccgctatc       420
     gcaatagcaa gtgcggcctc attgtggctg tttccctcgc tttcgacaca aatgatccta       480
     ttgatcattt ccgcagtaat cgggttgatg ttcctccata tcccgatagc aacttctgca       540
     gtccccatcc gtatttcgta tataccgctg atcctcttcc tcgccctttt catccttgtg       600
     ccgtttttcg tcgatgtgtc gaaatggatt gccctgttca acaccttttt tcaaagcggt       660
     gcacttgtct tcggtggtgg gcacgttgtc cttcctcttt tgcagcacgc tttgggtgat       720
     tcgatcacga cagagcgatt tttgtttggc tacgcagcgg cgcaggcagt tccgggaccg       780
     atgttcagcc tagcagcatt tttggggacc gatctctccc cctcttcgcc tctattaggc       840
     gcattggtcg cgacactatc catctttctc cccggctttc tgctcctgct tgggctctat       900
     cggggatggg aaatcctcgc tcaacgtccg cgcattgccg cagtcgcagc cggtctcaat       960
     gccgccgtag tcggcatcct ccttgcagct ttatataatc cagtctttac gagcggtgtc      1020
     acctccacca ttgatatggc attggtcgta acgggatttt ttttactgag aatgctaaaa      1080
     atccctgtcg tgggactact cccgatcttt gcgctatcag gagtcataat ttcagttaaa      1140
     tttgtttaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page