(data stored in ACNUC7421 zone)

EMBL: CP002355.PE417

CP002355.PE417       Location/Qualifiers
FT   CDS_pept        complement(408035..408475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr6985 hypothetical protein; SPTR:
FT                   Blr6985 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33085"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ7"
FT                   /protein_id="ADR33085.1"
FT                   /translation="MKRIGISVLILIAQLHANEPQSYTPGLGDMMGAVQIRHAKLWFAG
FT                   QNQNWKLATYELDEIKEGLEDAAVYHPIFKGKPIAKMMKISIAPALDQVEESIKQKNSS
FT                   QFIKAFETLSNACTSCHKNSGYGFIVIERPSTPPFSNQRFKP"
     atgaaacgca taggaatatc agtcctcata ctcatagccc aacttcacgc aaatgaaccc        60
     caatcgtata ctcccggatt aggagatatg atgggagcgg tacaaatacg gcatgcaaaa       120
     ctctggtttg cagggcaaaa tcaaaactgg aaacttgcga cttatgagct ggatgagatc       180
     aaggaggggc tagaagatgc cgctgtctat catccgattt ttaaaggcaa acctattgct       240
     aaaatgatga aaatctcaat agctccggct cttgatcaag tggaagaatc catcaagcaa       300
     aagaattcct ctcaatttat caaagccttt gagacacttt caaatgcgtg tacctcatgt       360
     cataaaaata gcggatacgg ctttatcgtc attgaacgtc caagtactcc gccgtttagc       420
     aatcaacgat ttaaacccta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page