(data stored in ACNUC7421 zone)

EMBL: CP002355.PE418

CP002355.PE418       Location/Qualifiers
FT   CDS_pept        408595..409230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0419"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: ant:Arnit_2164
FT                   response regulator receiver protein; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Response regulator receiver protein; PFAM:
FT                   Response regulator receiver domain; Transcriptional
FT                   regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33086"
FT                   /db_xref="GOA:E4TZJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ8"
FT                   /protein_id="ADR33086.1"
FT                   /translation="MGRILLLEDDEILSQTIMTILRSEGYEVYKAVNGREAYDLTFEHP
FT                   FDLYLFDVNVPESNGFEVLRELRKSGDETPTFFITALSDIQSVSQGFEAGANDYIKKPF
FT                   DLDEFVIRIRAALKRKYRTILYRDIAFEPNTQHVFINGLECDLSPVERMVFSLLVQNMD
FT                   RTVPKESFYEIMEKPSDAALRVHIAHLKQKLDLQIANIRSVGYRLELS"
     atgggacgta ttttactttt ggaagatgat gagatattgt ctcaaacgat catgacgatt        60
     ttacgtagtg aagggtacga agtctataaa gcggttaatg ggcgtgaagc atatgatttg       120
     acctttgaac atccgttcga tctctattta tttgatgtga atgtcccgga gtctaatggg       180
     tttgaagtat tacgcgaatt gagaaaatcg ggagatgaaa cacccacttt ttttattact       240
     gccctgagcg atattcaatc cgtatcgcaa gggtttgaag cgggagctaa tgactatatt       300
     aaaaagccgt ttgatctgga cgaatttgtg attcgtatac gtgcagccct aaagcgcaag       360
     tatcgaacca ttttgtatag ggatattgcg tttgaaccca atacccaaca cgtttttatc       420
     aatggattag aatgtgatct ctcacccgtt gaacggatgg ttttttcatt gttggtacag       480
     aatatggatc ggactgtacc caaagagtcg ttttatgaga ttatggaaaa accatcggat       540
     gcagctttgc gggttcatat tgcccatctc aaacaaaaac tcgatcttca gatcgctaat       600
     attcgcagtg taggataccg tcttgaacta tcgtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page