(data stored in ACNUC7421 zone)

EMBL: CP002355.PE419

CP002355.PE419       Location/Qualifiers
FT   CDS_pept        409217..410260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0420"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR003661: IPR003594: IPR004358: IPR005467; KEGG:
FT                   ant:Arnit_2163 integral membrane sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SPTR: Integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33087"
FT                   /db_xref="GOA:E4TZJ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZJ9"
FT                   /protein_id="ADR33087.1"
FT                   /translation="MNYREKESFIKSFSLFFVALFSMGAIALWLYHEEQQRFYQLQLLT
FT                   EMDAFSYVLQGEEFAYAIMNLDKDQPIHELIVKDTEVYALFPWVRNPDNEMVKVTYPHQ
FT                   EYLKYMDAESRKIWMLFLSLGFITVLLSAFFARYTLTPMRRSLLLMENFLKDIIHDLNT
FT                   PVSSILLNSQLLKRKYTDEEIDRIYISGQTITGLYKNLEVLYRQLPIEQDEVRLDTFLH
FT                   ERIRYFQTLYPSLSLTLEGEREMSISINRDILMRIVDNLLSNACKYNRSNGQVTVRYDQ
FT                   TSIEIIDTGIGIKHLDKVFHRFYKETERGLGMGLHIVKTLADRVGIAIEIESQKGIGTH
FT                   VTIHFLR"
     ttgaactatc gtgaaaaaga gtcgtttatc aagtcgtttt ctctcttttt tgttgcccta        60
     tttagtatgg gggctatagc actatggctt tatcatgagg aacagcagcg gttttatcaa       120
     ctccaattat tgacggagat ggatgcgttt agctatgtgc tgcaaggtga ggagtttgcc       180
     tacgcaatca tgaacctaga taaggatcag ccgattcatg aactgattgt caaggatact       240
     gaggtgtatg cccttttccc atgggtgaga aatccggata atgagatggt caaggtcact       300
     tatccccatc aagaatattt gaaatacatg gatgccgaat cgcgtaagat ttggatgctg       360
     ttcctttccc tcggattcat aaccgtactg ttatcagctt ttttcgcccg ttacaccctc       420
     acaccgatgc gccgatcttt gcttctgatg gaaaattttc tcaaagacat tattcacgac       480
     ctcaacactc cggtatcgtc tatactcctt aatagccagc ttttaaaacg caaatacacc       540
     gatgaggaga ttgaccgtat atacatcagt ggacaaacga ttacagggct atataaaaat       600
     ctcgaagtgt tgtatcggca gcttcctatc gagcaagatg aggtacgatt ggatactttt       660
     ttacacgaac gaatccgcta ttttcaaacc ctttatccct ccctttcact aacgcttgaa       720
     ggtgagcgtg aaatgagtat ttccattaac agagatattc tgatgagaat cgttgataat       780
     ctcctctcta atgcctgcaa atacaatcgt tcgaacggtc aggtcactgt gcgatacgat       840
     caaacctcca tagagatcat tgatacaggg atcggaatca aacatctcga caaagttttt       900
     caccgttttt ataaagagac tgaacgaggg cttgggatgg gtctgcatat cgtcaaaacc       960
     ctcgccgata gagtcggtat tgcgatagag atagagagcc aaaaagggat aggtacgcat      1020
     gtaacgatac attttttacg ctaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page