(data stored in ACNUC7421 zone)

EMBL: CP002355.PE420

CP002355.PE420       Location/Qualifiers
FT   CDS_pept        410324..411550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0421"
FT                   /product="sulfite dehydrogenase (cytochrome) subunit SorA
FT                   apoprotein"
FT                   /EC_number="1.8.2.1"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572:
FT                   IPR005066: IPR008335: IPR017909; KEGG: sun:SUN_1104
FT                   sulfite:cytochrome c oxidoreductase subunit A; PFAM:
FT                   oxidoreductase molybdopterin binding; Mo-co oxidoreductase
FT                   dimerisation domain; SPTR: Sulfite oxidase, putative; PFAM:
FT                   Mo-co oxidoreductase dimerisation domain; Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33088"
FT                   /db_xref="GOA:E4TZK0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK0"
FT                   /protein_id="ADR33088.1"
FT                   /translation="MKKINRRDFLGAGLILGASTLLGQETSKNLLPQGEEFIPPVIAFP
FT                   EKMPMKTISDRPPLLGSARGRELFTQAITPNNQFFVRWHLPDIPTYINLNEFRLEVKGS
FT                   VSTPLSLSIDDLKSKFEPAEVTAVLQCGGNSRKYYAVTGQATHGVQWDHDAMGCAIWRG
FT                   VRLKDILNRAGVKSSAKWIGLNGLEKPAMDETPDFFREMEIEEALEDQIIVAYAMNGED
FT                   LPYLNGFPIRLVIPGHFSDSWVKMLSEVMVMDTYRESFFMDVAYTVPDNDCECVISGND
FT                   FEYKRKPIAAMKVKSVIGYPLPGTAIKKGSRVKIAGVAFDQGKGIKEVMISLDSGKNWS
FT                   AAKLGEDHGKFAFRPWSYEWEPKTKGEYTIMVRAINRIGNIQPMPHEIGWNAGGYQYNA
FT                   VDSVSVQIV"
     atgaaaaaga ttaatcgtag agatttttta ggtgcaggtc ttattctcgg tgcatccact        60
     ctcttaggtc aagaaacctc caaaaattta cttcctcaag gtgaggaatt catccctcct       120
     gttattgcgt ttccggaaaa aatgcccatg aaaactatct cagatcgtcc tcctctatta       180
     ggttccgcaa gagggcgaga attgttcacc caagctatca caccgaacaa tcaatttttc       240
     gtccgctggc atctccctga tattccgact tatatcaatc tgaacgaatt tcgtctcgaa       300
     gtgaaaggtt ctgtttctac acctctttct ttgagcatcg atgatttgaa aagcaaattt       360
     gaacccgcag aagtaaccgc cgtcctccaa tgcggaggta acagccgtaa atattacgcg       420
     gttaccggac aagctactca tggtgtccaa tgggatcacg acgcaatggg atgcgctatc       480
     tggaggggag tacgtctcaa agatatcctc aatcgtgcag gagttaagag ttccgctaaa       540
     tggattggct tgaacgggtt ggaaaagccg gcaatggatg aaactcccga ttttttccgt       600
     gaaatggaga ttgaggaggc tctcgaagat cagattattg ttgcctatgc gatgaatggt       660
     gaagacctgc cttatctcaa cggttttccg attcgtcttg tcataccggg tcatttttca       720
     gatagttggg tcaaaatgct ctcagaggtc atggtcatgg atacctatcg agaaagtttc       780
     tttatggatg tcgcctacac agttcctgat aatgattgtg aatgtgttat ttcaggaaac       840
     gatttcgagt ataagcgcaa acctattgcc gcgatgaaag taaaatcggt cattggttat       900
     cctttaccag gtacggcgat caaaaaaggg tctcgcgtta aaattgcagg agttgccttc       960
     gatcagggca aagggatcaa agaggtaatg atttctcttg atagtggaaa aaactggagt      1020
     gcggctaaac tgggtgaaga tcacggcaaa tttgcatttc gcccgtggag ttatgagtgg      1080
     gaacccaaaa ccaaagggga atatacaatt atggtgcgtg ccatcaaccg aatcggtaat      1140
     atacaaccga tgcctcacga aatcggctgg aatgccggag ggtaccaata caacgccgtt      1200
     gattctgtta gcgttcagat tgtataa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page