(data stored in ACNUC7421 zone)

EMBL: CP002355.PE421

CP002355.PE421       Location/Qualifiers
FT   CDS_pept        411560..411877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0422"
FT                   /product="sulfite:cytochrome c oxidoreductase subunit B"
FT                   /note="KEGG: sun:SUN_1103 sulfite:cytochrome c
FT                   oxidoreductase subunit B; SPTR: Sulfite:cytochrome c
FT                   oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33089"
FT                   /db_xref="GOA:E4TZK1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK1"
FT                   /protein_id="ADR33089.1"
FT                   /translation="MKKIILLSALLISISFAQVAQPIEIPYVDYPMVKGDHDEVAQQYC
FT                   LICHSWGYILNQGKKSRPYWSGTVQKMVNEFKAPISKEEQQTIINYLVKHYGYENSVSG
FT                   H"
     atgaaaaaaa ttattttact cagtgcactt ttgatttcta tctcttttgc ccaagttgca        60
     cagccgatag agattcctta tgtcgattac cctatggtaa aaggagacca tgatgaagtg       120
     gcacagcaat actgtctcat ttgtcattca tggggatata tcctcaatca gggaaaaaaa       180
     agtcgtccct attggagtgg aacggtccaa aaaatggtga atgagttcaa ggctcctatc       240
     agtaaagaag agcagcaaac gattattaat tatctcgtca aacattatgg ctatgaaaat       300
     agtgtttccg ggcactag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page