(data stored in ACNUC7421 zone)

EMBL: CP002355.PE422

CP002355.PE422       Location/Qualifiers
FT   CDS_pept        411951..412886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0423"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: tdn:Suden_0648 von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: von
FT                   Willebrand factor, type A; PFAM: von Willebrand factor type
FT                   A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33090"
FT                   /db_xref="GOA:E4TZK2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK2"
FT                   /protein_id="ADR33090.1"
FT                   /translation="MLIGNISAMNIWSFDFAWAFLALPPILYCLYRCKVIPQKRYFPHL
FT                   QFFGNPGKWRNLEWLFKALAVTLMVGALATPVVVDYSDPRNRNGIDIVLSLDGSGSMNA
FT                   SGFSKEEPRLSRFEVVQKIASDFVMKRIEDNVGVVLFGDFAFIATPVTYEKEIVSEMIG
FT                   YLSHGMAGQNTAIGEGIAMGVRALRDSKAKSKVIILLTDGEHNSGSISPKEAVAMVGKE
FT                   HIRLYTIGIGQKGEFDNALLKQLAHDGHGKFFAAANEKELQSVYDEIDMLERSKIKSKQ
FT                   HTFEEHYYQWFGAAALGVLLILMWRRRIGS"
     atgctaatcg gtaatatttc agctatgaat atctggtcat ttgattttgc atgggcattt        60
     ttagcactcc ctccgatact ctattgcctc taccgttgta aagtcatccc ccaaaaacgg       120
     tactttcccc atttgcaatt tttcggcaac ccgggaaaat ggcggaattt agagtggctc       180
     ttcaaagcac ttgccgtgac gctgatggtg ggagccctgg caacacccgt cgtggtcgat       240
     tattccgatc cccgcaaccg aaacggcatc gatatcgtcc tctcgcttga cgggagcggg       300
     tcgatgaatg catccggctt ttcgaaagag gaaccgagat tgtcgcgctt tgaagtggtg       360
     caaaaaatcg cctccgattt tgtgatgaag cgcatcgaag acaatgtggg tgtggtactg       420
     ttcggcgatt tcgcatttat cgcaacgccg gtgacctatg aaaaagagat cgtttcggaa       480
     atgatcgggt atcttagcca cggaatggcg gggcagaata ccgccatcgg cgaggggatc       540
     gcgatggggg tgagggcatt gcgggactca aaagccaaaa gcaaggtcat tatcctcctt       600
     accgacggtg agcacaacag cggctccatc tcccctaaag aggcggtggc gatggtaggc       660
     aaagagcata tccgactcta tacgatcgga ataggccaga aaggtgagtt tgacaatgct       720
     ctgctcaaac agctcgccca tgacggccac ggaaagtttt ttgccgctgc gaacgaaaaa       780
     gagcttcaga gcgtctacga tgagatcgat atgctggagc gctcaaagat caaaagcaag       840
     cagcatacct tcgaagagca ctattaccag tggttcggtg ccgcggcatt gggcgttctt       900
     ctgatcttga tgtggcgcag gagaatcggg tcatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page