(data stored in ACNUC7421 zone)

EMBL: CP002355.PE423

CP002355.PE423       Location/Qualifiers
FT   CDS_pept        412883..414406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0424"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035: IPR001440: IPR019734: IPR013026;
FT                   KEGG: tdn:Suden_0649 von Willebrand factor, type A; PFAM:
FT                   von Willebrand factor type A; Tetratricopeptide TPR_1
FT                   repeat-containing protein; SMART: von Willebrand factor
FT                   type A; Tetratricopeptide repeat; SPTR: von Willebrand
FT                   factor, type A; PFAM: von Willebrand factor type A domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33091"
FT                   /db_xref="GOA:E4TZK3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK3"
FT                   /protein_id="ADR33091.1"
FT                   /translation="MMFLTPLWLGALVIVPLYVWQVKRSGWSKQGWLLASIALLILSLA
FT                   RPVLPQKPVTAEEAGSDVIFAVDLSYSMRGTDLAPSRLEVAKKLLYDVVRSDQKDRFGV
FT                   IGFTTSAIVLSPLTKDTEMLEHLFSSLDESQIITKGTNVMSALELSRKMSHSARPIVIL
FT                   LTDGGDEASYEKESSFVRDNNLALSVVMLATNNGSTLPTSEGSSLKDENGHIVVSARND
FT                   AIEEIVNKGKVIRNTRAGEILSLIDSARENDFTGKTSVMRYQELFYVPLMLSLIAFVAA
FT                   FTTVGKKISRLFIPALALIGVSAQGGMLDFGYIYLAEINYTHGNFERSAELYRHVEGER
FT                   ARYNRANALYKAGKYADALGLYRSIRSNNASFKANIFYNMGNCHIRLQEFGEARESFLK
FT                   SLTLRYTRAADQNLRAITEVKEHQTLNVRKEKNDSFASEENKPTGAKKTSKEGGGSNMK
FT                   TDTASGGGGDEGKRAQSDPRFSMSQGKAALSSRQYELINQRSVHETKPW"
     atgatgtttt taacaccgtt atggcttggc gcccttgtga ttgttccgct gtatgtttgg        60
     caggttaagc gcagcggatg gtccaaacag gggtggctct tggcatccat agccctttta       120
     atcctctctc ttgcacgtcc ggtattgccg caaaaaccgg ttacggccga agaggcggga       180
     tcggatgtga tctttgcggt ggatctgtcg tattcgatgc ggggaaccga tcttgccccc       240
     agccgtctgg aagtggcaaa aaaactgctg tacgacgtcg ttcggagtga tcaaaaagac       300
     cggttcggtg tcatcggatt tactacaagt gccatcgtcc tctcgccgct gaccaaggat       360
     actgagatgc ttgagcatct tttttcttct cttgatgagt cgcagatcat caccaaaggg       420
     acgaacgtga tgagtgcatt ggaactctcc cgtaaaatgt cccattcggc acgtccgata       480
     gtgatcttgc tcaccgatgg gggagatgaa gcatcgtatg aaaaagagag ctcttttgta       540
     agggataaca atctggcact cagtgtcgtg atgttggcaa caaacaatgg aagtaccctt       600
     ccgacatccg agggatcgtc tttaaaagac gaaaacggac atatcgtcgt cagtgcacgc       660
     aatgacgcga ttgaagagat cgttaataag ggaaaggtta tccgaaatac acgagcggga       720
     gaaatacttt cgctcatcga ttccgcccgc gaaaacgatt ttacgggtaa aacatcggtg       780
     atgcgctatc aagaactttt ttacgtccct ctcatgttgt cattgatcgc ttttgttgcg       840
     gcgtttacga ccgtcggcaa aaaaatctcc cgtctgttta taccggcact ggcattgatc       900
     ggcgtatcgg cacagggggg gatgctcgat tttgggtata tctatttagc cgaaataaat       960
     tacacgcacg gaaattttga gcggtccgcc gagctgtatc gccatgttga gggggagaga      1020
     gcccgctata accgtgcgaa tgccctctat aaagcgggaa aatatgccga tgcgttggga      1080
     ctttaccgct caatccgcag caacaatgcc tcttttaaag ccaacatttt ttacaatatg      1140
     ggcaattgtc atatacgtct gcaggagttc ggcgaagcgc gcgagtcgtt tttgaaatct      1200
     ctgacgcttc gctataccag agccgccgat caaaatcttc gtgcaattac ggaagtaaaa      1260
     gaacatcaga cactgaatgt ccgcaaagag aaaaatgaca gcttcgcttc cgaggagaat      1320
     aaaccgacgg gagcgaaaaa aacctcaaaa gaggggggcg gctccaatat gaaaaccgat      1380
     accgcatccg gaggcggagg cgatgagggg aagagggcgc aaagcgatcc gaggttttcg      1440
     atgtcgcagg gtaaagctgc gctcagctca cgccaatatg agctgatcaa tcaaaggagt      1500
     gtgcatgaga cgaagccttg gtag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page