(data stored in ACNUC7421 zone)

EMBL: CP002355.PE424

CP002355.PE424       Location/Qualifiers
FT   CDS_pept        414387..415502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0650 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33092"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK4"
FT                   /protein_id="ADR33092.1"
FT                   /translation="MRRSLGRAVILMVLCPLLGWGAMYQWSVLKSPQSLYVNQSGVIRY
FT                   ECTFSTSAADYTITFNPISNESYKVSILTQRDQIIGGKRVQTFDVLITPKKEGNIDVSL
FT                   EALIRHTTFASIENASIGRDNVKKYDFDDEKAHLPKVVIEAKPNSAALSGELSLEVKVD
FT                   KRNALAHEPVHLSLYIRGRGNLDQYTPYELNISGVNIFGEEPIRDISPDPAGFAGEIRQ
FT                   EFAIVSDKSYVIPSITLDVFDSTTQKIKRLQSDSIAIEVAQGFERSDLLDPPGLRDWSN
FT                   LARYSLYAALVIAGAVLGEIARRLWRLRPRRKSKQFWDEAKNPKELAMFLALSGDKRYD
FT                   EIIGLLESGAVGLGEAKKKLSTLTTDKEEIA"
     atgagacgaa gccttggtag ggcggtgata ctgatggtat tatgtccgct tctggggtgg        60
     ggggcaatgt atcagtggag cgttctcaaa tcccctcaaa gcctctatgt caatcaaagc       120
     ggggtcatac gctatgagtg taccttttca accagtgcgg cggattatac gatcactttt       180
     aaccctataa gcaatgaaag ctacaaagtt tcaatattga cgcagcgcga tcagatcatc       240
     gggggaaagc gggtgcagac gtttgacgta ctgattaccc cgaaaaaaga gggaaatatc       300
     gatgtatcgt tggaagcatt gatacgccat acgactttcg cctcaatcga gaacgcgtcg       360
     atcggacggg ataacgtcaa aaaatacgat ttcgacgatg aaaaagcgca tttgccgaaa       420
     gtagtgattg aggccaaacc caacagtgcg gcgctcagcg gagaactttc actggaggta       480
     aaagtcgata agcgtaatgc gcttgcccac gagccggttc atctaagcct ctatattcgg       540
     ggacgcggaa atctcgatca gtatactccg tatgaactca acatcagcgg agtcaacatt       600
     tttggtgagg aaccgatacg tgatatttct ccggatccgg ccgggtttgc gggggagata       660
     cgtcaggagt tcgccattgt gagcgataaa agctatgtca tcccgagtat taccctcgat       720
     gtctttgatt cgacaacgca aaaaatcaaa cggcttcaaa gcgatagtat cgcgatagag       780
     gtcgctcagg ggtttgagcg ctccgatctt ctcgatcctc cgggcttgcg tgactggagc       840
     aatttggcac gatacagcct ctatgcggca ttggtgattg cgggtgcagt gttgggagaa       900
     atcgcacgac ggttatggag attgcgcccc cgtcgaaaat caaagcagtt ctgggatgag       960
     gctaaaaacc cgaaagagct ggcgatgttc cttgctctaa gcggtgataa gcggtatgac      1020
     gagattatcg gcttgcttga atcgggtgcg gtcggattag gtgaagctaa aaagaaatta      1080
     agtacactca caacagataa agaggaaata gcatga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page