(data stored in ACNUC7421 zone)

EMBL: CP002355.PE426

CP002355.PE426       Location/Qualifiers
FT   CDS_pept        416449..417282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0427"
FT                   /product="protein of unknown function DUF58"
FT                   /note="COGs: COG1721 conserved hypothetical protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain); InterPro IPR002881; KEGG: tdn:Suden_0654
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF58; SPTR: Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33094"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK6"
FT                   /protein_id="ADR33094.1"
FT                   /translation="MKNSRHILLKARRQIIGDRIGNNPSMFRGEGYDFIELREYVSGDD
FT                   TRHIDWNITAKMQRPFIKVFREERELSVVTVAMLGGSLHFGQERFKIDALAEAVALIGY
FT                   SALANGDLFTHIDFSETLRNEVRASKKRFAVAQSVEGIMDTPILQHRADYNAMASSLYR
FT                   RLKRRSLIVVIGDFFEIPDLRLLAKKHEVVAVVVRDRFEEKPSPMGFSALIDPQSGAVL
FT                   EGDFNARSVRKYHEKVREHDAGLFDRLRRDGIRAAKLYTDASVSVVLRRLFEGRV"
     atgaaaaaca gccgccatat tcttctcaaa gctcgacgcc agattatcgg tgatcgtatc        60
     ggcaataacc cctccatgtt tcggggggaa gggtacgatt ttatcgaatt gcgcgaatac       120
     gtcagcggcg acgatacccg ccatatcgac tggaacatta cggccaaaat gcagcgtccg       180
     tttatcaaag tttttagaga agagcgtgaa ctctccgtcg taacggtggc gatgctcgga       240
     gggagtctgc atttcggtca ggagcggttc aaaattgatg cgcttgccga agcggtggca       300
     ttgatcggct attcggctct ggctaacggg gatcttttta cccatatcga cttttccgaa       360
     accctccgca acgaggtgcg tgcgagcaaa aaacgttttg ccgtagcgca gagcgtcgag       420
     gggatcatgg atacgccgat actgcagcac cgtgctgatt ataatgcgat ggcatcatcg       480
     ctctaccgcc gattaaaacg gcgctccttg atcgtcgtta tcggcgattt tttcgagatt       540
     cccgatttgc ggctgctggc aaagaaacac gaagtcgtgg ccgtcgtcgt gcgtgaccgt       600
     ttcgaagaga aaccctcccc gatggggttc agcgccctga ttgacccgca aagcggtgcg       660
     gtgttggagg gggatttcaa tgcccgcagt gtccgtaaat atcatgagaa agtccgtgaa       720
     cacgatgcgg gactgtttga tcggctgcgg cgtgatggaa tccgagcggc aaaactctat       780
     accgatgctt cggtttcggt ggtactgcga agattatttg aggggcgcgt atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page