(data stored in ACNUC7421 zone)

EMBL: CP002355.PE427

CP002355.PE427       Location/Qualifiers
FT   CDS_pept        417279..417677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0655 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33095"
FT                   /db_xref="GOA:E4TZK7"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK7"
FT                   /protein_id="ADR33095.1"
FT                   /translation="MSQMADIPVNDIAPLVQVHDYSIYLFGGSVTIAFVITLSLILFVL
FT                   KKWRARRLSERKRLYHLLGSIDLSDSKRAAYKISELGRIFSADNERTERAYHNLFERLE
FT                   PYKYAPKVEPFTEEVVGYYRLYLEIIDV"
     atgagccaga tggcagacat tcccgtgaat gacatcgcac cgctcgttca ggttcacgat        60
     tattcaattt accttttcgg cggttctgtg acgattgcat ttgtcataac cttgagcctt       120
     attctgttcg ttctcaaaaa atggcgcgct cgccggctca gcgaacgaaa acgtctctat       180
     caccttttag gatcgatcga tctctccgat tctaaacgcg cagcgtataa aatcagcgaa       240
     ctcggcagga tattttctgc cgataatgaa cgtaccgagc gtgcttatca caatcttttt       300
     gaacgtctgg aaccgtacaa atatgctcct aaagtagaac cgtttaccga agaggtagtc       360
     ggatactatc gtctttacct cgagatcatc gatgtttga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page