(data stored in ACNUC7421 zone)

EMBL: CP002355.PE428

CP002355.PE428       Location/Qualifiers
FT   CDS_pept        417670..418410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0656 von Willebrand factor, type A;
FT                   SPTR: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33096"
FT                   /db_xref="GOA:E4TZK8"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK8"
FT                   /protein_id="ADR33096.1"
FT                   /translation="MFEGIYFQFPKLAFLLFFFLACEALCPLRSNPLYFPRPILFGEVG
FT                   VKPPIWLWIAKWAMIAFLVIALMSPVRDREAARHERGWDILLIVDPLLTGTAAIPQIIS
FT                   FMNRRMDERIALWVPENTIVPLTYEHKALISILKQTPVPESSGEATLNISRFFATSQEG
FT                   HKVAIIFSENPKSFLTTLPIGIQTAMISPLKEPQWADTLNRTYPSYKVKQSHRYFDYYY
FT                   VYPLFLGFLSMLAYLYGRNQKGIR"
     atgtttgagg ggatctattt tcagtttccg aaactggcct ttctcctctt tttttttctc        60
     gcctgtgaag cgctttgtcc ccttcgatcc aatcccctct atttcccccg tcccatctta       120
     ttcggtgaag ttggggtaaa gccgccgata tggttgtgga tcgccaaatg ggcgatgatt       180
     gcgtttttag ttattgcatt gatgtctccc gtgcgcgatc gcgaagctgc ccgtcatgag       240
     agaggctggg atatactttt gattgtcgat cctttattga caggtacggc ggcgattccg       300
     caaatcatct catttatgaa tcgacgcatg gacgagagga tagcgctttg ggtccctgaa       360
     aacactattg tccctttgac gtatgagcat aaagccctta tttctatcct caagcagact       420
     cctgtgcctg aatcttccgg agaagctacc ctaaatatca gccgtttttt cgctacgtcg       480
     caggaggggc ataaagtcgc cataatattt tcagaaaatc cgaaatcttt tctcactact       540
     ttgccgatcg ggattcaaac ggcaatgatc tctccactca aggaaccgca gtgggcagat       600
     acgctcaacc gaacctatcc ctcctataag gttaaacaat ctcatcgata ttttgattac       660
     tattacgtct atcccctctt tttaggattt ctttcgatgc tggcgtattt gtacggacgc       720
     aatcaaaaag ggatccgatg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page