(data stored in ACNUC7421 zone)

EMBL: CP002355.PE429

CP002355.PE429       Location/Qualifiers
FT   CDS_pept        418407..419543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0657 von Willebrand factor, type A;
FT                   SPTR: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33097"
FT                   /db_xref="GOA:E4TZK9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZK9"
FT                   /protein_id="ADR33097.1"
FT                   /translation="MSFLHAEFFVWMVLPVLVLFYFWQTQKSPHSAVFGEAVFNRLHAP
FT                   EITMGLRTRNILFLIAALLLIAAMAQPVILQDEAASEGRADVLIALDLSKKSLEAFEEE
FT                   KRTAINTIRRLKGENIAVFGYDTRPYRITPYTTDSEMAAALVSGLDSEVMRQFKSDSSA
FT                   LDKFRSDEGMIIIIGDPTNEHNTRLSGIIERIEKIKTAQRLYVHVPLFYYPLGLAMVLI
FT                   WIALSSMSKRRSVPAAAILMALSIGNVSGHAGILDFQILNSGYRAYEKGDYLQSAHYFK
FT                   SYQNAHDSPEIRYNIANALYKAGAYREALYWYRQVHTSNPLLAQKAAYNLSLCEAKIHI
FT                   GSKSGENQKRDRDEPISHEIQPLPKKSPNEIKTRLYPM"
     atgagttttt tgcatgccga attttttgtc tggatggttc tgccggttct tgtactgttt        60
     tatttctggc agactcaaaa gtccccccat tccgccgtat tcggcgaagc cgtttttaac       120
     cgcctgcatg cgccggaaat tacgatgggg ctgcgaacca gaaatatttt gtttttgatt       180
     gccgcccttt tgctgatcgc tgctatggca cagcctgtga tacttcagga cgaagcggca       240
     tcggagggga gggcagacgt attgatcgct ttggatctct ccaaaaagtc gcttgaagca       300
     tttgaagaag agaaacgaac ggcgatcaat acgatccgac gtcttaaggg ggagaatatc       360
     gccgtattcg gctatgatac acggccctat cgtatcactc cctacacgac ggattcggaa       420
     atggcggcgg cattggtcag cgggttggat tctgaggtca tgcggcagtt taaaagcgat       480
     agctcagcgc tagataaatt ccgatccgac gaggggatga taattattat cggagatccg       540
     acaaatgagc ataatacccg gctttccggg attattgaga ggatagaaaa aatcaaaacc       600
     gctcagcgcc tttatgttca tgtacccctt ttctactatc ctctgggact ggcgatggtg       660
     ctgatttgga tagccctctc ttcgatgagt aaacggcgta gcgtccccgc cgccgcgatt       720
     ttaatggcgc ttagtatagg gaatgtttcg gggcatgcgg ggatattgga ctttcaaata       780
     ctcaatagcg gatatagagc atacgaaaaa ggcgattacc tccaaagcgc acactatttc       840
     aaatcatacc aaaatgctca cgactctcct gaaatacgtt ataacattgc caatgccctt       900
     tataaggccg gagcgtatcg ggaagcactg tattggtatc ggcaggttca tacgagcaac       960
     ccgcttttag cgcaaaaagc agcctataac ctctctcttt gcgaagccaa gatccatatc      1020
     gggagcaaaa gcggtgaaaa ccaaaaaagg gatcgggatg agccgatttc acacgaaatt      1080
     cagccactac cgaaaaagag tcctaacgag ataaagacgc gtctttatcc tatgtga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page