(data stored in ACNUC7421 zone)

EMBL: CP002355.PE43

CP002355.PE43        Location/Qualifiers
FT   CDS_pept        42898..43401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0043"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.5"
FT                   /note="COGs: COG2077 Peroxiredoxin; InterPro IPR018219:
FT                   IPR017936: IPR013740; KEGG: tdn:Suden_0132 thiol
FT                   peroxidase; PFAM: Redoxin domain protein; SPTR: Thiol
FT                   peroxidase (Atypical 2-Cys peroxiredoxin); PFAM: Redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32711"
FT                   /db_xref="GOA:E4TW95"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW95"
FT                   /protein_id="ADR32711.1"
FT                   /translation="MATTMLKGNVVNLAGNTVNVGDKAPAVTVVNSNGLADKVVGGASG
FT                   KKQLIVVVPSLDTAVCATETRNFNKRASEIEGVDLTVVSMDLPFAAGRFCSTEGIENLV
FT                   VASDFRNKDFANAYGVLIADGALAGVTCRAIFAVNEEGTVIYKEIVPEITAEPEYEAAL
FT                   AAVK"
     atggcaacaa caatgctaaa aggtaacgtc gtaaatcttg caggaaacac agtaaacgta        60
     ggtgataaag cgcctgctgt aacggttgtc aattcaaatg gtctagctga caaagtagtc       120
     ggcggtgcat caggtaaaaa acaacttatc gttgttgttc cgtcacttga tacggctgta       180
     tgtgcaactg aaacacgtaa cttcaacaaa cgtgcatctg aaatcgaagg tgttgatttg       240
     acagttgtct ctatggacct tccgtttgct gcaggacgct tttgttcaac agaggggatt       300
     gaaaaccttg ttgtagcatc agatttccgt aacaaagatt tcgcaaacgc atacggcgta       360
     ttgatcgctg acggtgcact tgcaggtgta acatgccgtg ctatttttgc ggtaaacgaa       420
     gaaggaactg ttatctacaa agaaatcgta cctgaaatca ctgctgagcc tgaatacgaa       480
     gctgcattgg ctgccgtaaa ataa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page