(data stored in ACNUC7421 zone)

EMBL: CP002355.PE431

CP002355.PE431       Location/Qualifiers
FT   CDS_pept        420488..422728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0432"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="COGs: COG4775 Outer membrane protein/protective
FT                   antigen OMA87; InterPro IPR016474: IPR010827: IPR000184:
FT                   IPR020785; KEGG: tdn:Suden_0660 surface antigen (D15);
FT                   PFAM: surface antigen (D15); surface antigen variable
FT                   number repeat-containing protein; SPTR: Outer membrane
FT                   protein assembly complex, YaeT protein; TIGRFAM: outer
FT                   membrane protein assembly complex, YaeT protein; PFAM:
FT                   Surface antigen variable number repeat; Surface antigen;
FT                   TIGRFAM: outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33099"
FT                   /db_xref="GOA:E4TZL1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL1"
FT                   /protein_id="ADR33099.1"
FT                   /translation="MKTITLSLIVASALVHASAQNVQSIHYDGMVHISEAVAKRLNEVK
FT                   VGEPLNAAAVDKTVKNFFEQGYFEDVWAEEEEGKVTFHFKEKPTISKIELKGYKENDEE
FT                   AKKALLQIDKGSLYDPKRVEEAKKRIVDALSQDGKIDSVVEIETEKLENGSMRVTFIAN
FT                   EGQEIIIKKLTYAGVLTQDSEEFDSMIANKEEQFMGWMWGRNDGKMKVAELQYDPLRIR
FT                   DFYMQRGFLDAKIDEPFVAVDFDHYTAQMSYNIFEGDVYRVSDILLFQDTKVIDDQALL
FT                   DVITLEKNKPFNIKTFREDAERIKTKIADLGYAYVQVQPDLKKDKEGKSVDVVYRIIPG
FT                   KKVHIRKVIISGNNRTLDRVVRRELFLAPGDLYSLTNLKDSRNAIGRTGYFESNTIEEK
FT                   RIDDETMDLIVQTKEAPTGNIQLGGGYGSFGGILVSVAVSDRNIFGSGINVGLNLEKSQ
FT                   RTSNYSFNISNPRLNDSDFSGNFSVYNSSTEYDSYSTDSKGISVGTGHRFNRFVNGYVG
FT                   YNYSQNSYSDIDLNTTTLDPRYYESYSKSSVVVSATFDNTDDYYVPREGMTLSESIEMA
FT                   GVGGDAEFWKSRTTFGVYQGLQKWTDFDLILRYKARFNYASEGGGYLPLGEKFYMGGIG
FT                   SVRGYQAYSISPTKGVDRNGDPYKIGGTQTFSNNLEFSVPLVPEAKMRATAFIDYGMIG
FT                   ESSISEIKRGGYGVSLEWFSPVGPLQLVFANPIGDKEHDDIAHFEFTIGQRF"
     ttgaaaacaa ttaccctctc tttgatagtc gcaagtgcat tagtgcacgc atctgcgcaa        60
     aacgtccaat cgatccacta tgacggaatg gttcatattt ccgaagctgt cgcaaagcgg       120
     cttaatgagg ttaaagtcgg tgagccttta aatgctgccg ccgttgataa aacggttaaa       180
     aactttttcg agcaaggcta ttttgaagat gtttgggcag aggaagaaga ggggaaagtc       240
     acttttcatt tcaaagagaa accgactatc tctaaaatcg agctgaaagg gtataaagag       300
     aacgatgaag aggcaaaaaa agctttgctt caaatcgata aaggttctct gtatgatcct       360
     aaaagagtcg aagaagccaa aaagcggatt gtcgatgcgt tgagccagga cggtaaaatt       420
     gattcggtgg tcgaaatcga gaccgaaaag cttgaaaacg gcagtatgcg tgttaccttt       480
     attgccaatg aagggcagga aattatcatt aaaaagctca cttacgcggg agttttaaca       540
     caggattccg aagagttcga cagcatgatc gccaataaag aagagcagtt tatggggtgg       600
     atgtggggac gtaacgacgg taagatgaaa gtggccgagt tgcagtacga cccgctccga       660
     atccgcgatt tttatatgca gcgcggtttt ctcgatgcca aaatcgacga gccgtttgta       720
     gcggtcgatt ttgatcacta tacggcccag atgagctata acatctttga aggggatgtt       780
     taccgcgtat ccgatatttt gctgtttcaa gataccaaag tgattgacga tcaggcgctt       840
     ctggacgtca tcaccttgga aaaaaacaaa ccgttcaata tcaaaacgtt ccgtgaggat       900
     gcggagcgga tcaagacaaa aattgccgat ttgggatacg cttacgttca ggtacagccc       960
     gatttgaaaa aagataaaga agggaaaagc gttgatgtcg tataccgcat tatcccgggc      1020
     aaaaaagtac atatccgtaa agtgatcatt tcagggaata accgaacgct ggaccgtgta      1080
     gtccggcgtg agcttttctt ggcaccgggc gatctttata gcttgacaaa cctcaaagac      1140
     tcccgtaatg cgatcgggcg taccggatat tttgagagta atacgattga agagaaacgg      1200
     attgatgatg agacgatgga tcttatcgtc caaaccaaag aggcaccgac agggaatatt      1260
     cagctcggtg gaggatacgg gagcttcggc ggtatcttgg tcagtgtggc ggtgagcgat      1320
     cgcaatattt ttggttccgg gatcaatgtc gggctcaatc ttgagaaatc tcagcgtacc      1380
     agcaactact ctttcaatat ttccaacccg cgtctcaacg acagtgattt cagcggcaat      1440
     ttttccgtct ataacagttc gaccgaatac gatagctata gcaccgattc caaagggata      1500
     agtgtcggaa cgggacaccg ctttaaccgt tttgtaaacg gctatgtggg gtacaactat      1560
     tcacaaaaca gctacagcga tattgatctt aatacgacaa cgcttgatcc acgctattac      1620
     gaaagctact ctaaaagctc tgtcgtcgtt tcggcgacgt ttgacaatac cgatgactat      1680
     tacgttccgc gtgaggggat gacactttcg gagagtatcg aaatggccgg ggtcggcggg      1740
     gatgcggagt tttggaaaag ccgtaccact ttcggcgtct atcaagggct tcagaaatgg      1800
     accgattttg acctgatcct tcgctataaa gcccgcttta actatgccag tgaagggggc      1860
     ggttatctcc cgctgggtga gaaattctat atggggggga tcggttcggt tcgcggatat      1920
     caagcatact ccatttcacc gacaaaaggg gttgacagaa acggagatcc gtataaaatc      1980
     ggcggaactc aaacgttttc caataacctt gagttcagtg tccctctggt tccggaagca      2040
     aaaatgcggg caacggcatt catcgattac ggtatgatcg gtgagagcag tataagcgag      2100
     atcaaacgcg gaggttacgg ggtttcttta gaatggttca gccctgtcgg accgcttcag      2160
     cttgtattcg ccaatccgat cggcgataaa gagcacgatg atatcgccca cttcgaattt      2220
     acaatcgggc agagatttta g                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page