(data stored in ACNUC7421 zone)

EMBL: CP002355.PE434

CP002355.PE434       Location/Qualifiers
FT   CDS_pept        complement(424687..425988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0435"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR003660: IPR003661: IPR003594: IPR004358: IPR
FT                   005467; KEGG: tdn:Suden_0663 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SPTR: Histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33102"
FT                   /db_xref="GOA:E4TZL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL4"
FT                   /protein_id="ADR33102.1"
FT                   /translation="MFSKRSIRRRFLFQLIVASAALVILFSSFLYLFIKQSIYDEKQAE
FT                   LIGYAENISSYKSLLSTQQNNADTMMGLTVELITLSQNDEHLDFYETTHKDKSTTLTLI
FT                   YPFDFEHSSYLKVSRDITPTKRLLRKIMNSIYLINAVGFVVIILYAIAFSKMLIAPISA
FT                   LSRRLANMNEHLIRPIKVEQLPDEFEPLGETLNRLIARIQNFVKYQKELFIGAAHELKT
FT                   PLAVIKLKNQVTLIKKRTPEEYIEAIKITNQSVDEMNKIVADILNIGRQEGAQLEIPVQ
FT                   TDIIQILKKWEGDFKLLANSENKTLLTRFEPDAFSAVLQVTLLNQILQNFLQNALKFTP
FT                   EGKTILFQSHMNGVGIVIEVIDEGCGIDESVDLFAPFKRQGNKSGVGLGLFLAKSAAEA
FT                   IGATITLTNREDGIDGTCARLILPSKLCCVIPQR"
     ttgttttcca aaagaagcat aagacgacgc tttctctttc aactcattgt cgcttcggcg        60
     gcattggtta tccttttttc ctcctttttg tatcttttta tcaaacaatc gatttacgac       120
     gaaaaacagg ctgagctgat cggttacgcc gaaaatatct cctcgtataa atccctttta       180
     tccacccagc agaataatgc cgatactatg atgggactta cggtagagct cataaccctg       240
     agccaaaacg atgaacacct cgatttttac gaaacaaccc ataaagacaa aagcacgacg       300
     ctgacgctca tctacccgtt tgactttgaa cactcgtcgt atctgaaagt gagccgtgac       360
     atcaccccga ccaagcggct gctccgaaaa atcatgaact cgatttatct tatcaatgcc       420
     gtcggttttg tcgtcattat cctctatgcc atcgcgtttt caaaaatgct gatcgctccg       480
     atcagtgcac tgagccgccg gctagccaac atgaacgagc atttgatccg ccctatcaaa       540
     gtcgaacagc tccctgatga atttgaacct ctgggtgaga ctctcaaccg tctcattgcc       600
     cgtattcaaa acttcgtcaa ataccaaaaa gagctcttca tcggtgcggc acatgagctt       660
     aagacccctc tcgccgtcat caaacttaaa aatcaggtca cgctgattaa aaagcggact       720
     cccgaagagt acatcgaagc catcaagatt acgaatcaaa gtgtcgatga gatgaataaa       780
     atcgtcgccg acatcctcaa tatcgggcgt caagaggggg cacaacttga aatcccggtg       840
     caaaccgata ttatccaaat cctaaaaaaa tgggaaggtg atttcaagct cttggcaaac       900
     agcgaaaaca aaacgctcct cacccgattt gagcccgatg ctttcagtgc cgtattgcaa       960
     gtaacccttc tcaatcaaat tttgcagaat ttcttgcaga atgctctcaa atttactccg      1020
     gagggaaaaa ctatcctttt tcaaagccat atgaacgggg tagggatcgt tatcgaagtg      1080
     attgatgagg gatgcggtat cgatgagagt gtcgatctat ttgcaccgtt taaacgccaa      1140
     ggaaacaagt cgggtgtagg gttggggctc tttttagcca aaagtgccgc agaagcgata      1200
     ggagctacta ttactttaac aaatagagag gacggaatcg acggcacatg tgcccgcctt      1260
     atcctcccct cgaaactgtg ttgcgtcatt ccgcaacgat aa                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page