(data stored in ACNUC7421 zone)

EMBL: CP002355.PE435

CP002355.PE435       Location/Qualifiers
FT   CDS_pept        complement(425967..426638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0436"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_0664
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33103"
FT                   /db_xref="GOA:E4TZL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL5"
FT                   /protein_id="ADR33103.1"
FT                   /translation="MRILIIEDEVTLNKTLAEGLKEFGYQSDVVETLKDGEYYLDIRNY
FT                   DLILMDWMLPDGNSVDIIPDIKSNTPKTVVVVLSARDDNESEIEALKSGADDYIRKPFD
FT                   FDVLVARIEARLRFGGSNIIEIDDLTINPEEEKIIYKEKEIELKGKPFEVLTHLARHRD
FT                   QIVSKEQLLDAIWEEPELVTPNVIEVAINQIRQKMDKPLGITTIETVRRRGYRFCFPKE
FT                   A"
     atgcgtattc tgatcattga agatgaagta accctcaaca aaacccttgc agaagggctc        60
     aaagaatttg gttaccaaag cgacgtcgtt gaaacgttaa aagacggcga atattatctc       120
     gatatccgta attatgacct aatcttgatg gattggatgt tgcctgacgg taacagcgtc       180
     gatatcatcc cagacattaa aagcaacacg cctaaaaccg tagtagttgt tctctcggca       240
     cgtgatgaca acgaaagcga aatcgaagca cttaaatcgg gtgccgatga ttatatccgc       300
     aaaccgtttg attttgacgt ccttgtcgcc cgtatcgaag cacgcttacg tttcggtgga       360
     agcaatatca tcgaaatcga tgatttgacg atcaatcctg aagaggaaaa aatcatctat       420
     aaagaaaaag agatcgaact taaagggaaa cctttcgaag tattgactca ccttgcccgt       480
     caccgtgacc aaatcgtctc taaagagcaa ttgcttgatg cgatctggga agagcctgaa       540
     ctcgttactc cgaacgttat cgaggttgca atcaaccaaa tccgccaaaa aatggataaa       600
     ccgctcggaa ttactacgat cgaaactgta cgccgccgag gataccgctt ttgttttcca       660
     aaagaagcat aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page