(data stored in ACNUC7421 zone)

EMBL: CP002355.PE436

CP002355.PE436       Location/Qualifiers
FT   CDS_pept        complement(426717..427043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0437"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="COGs: COG1539 Dihydroneopterin aldolase; InterPro
FT                   IPR006157; KEGG: sun:SUN_1982 hypothetical protein; PFAM:
FT                   dihydroneopterin aldolase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Dihydroneopterin aldolase; TIGRFAM:
FT                   dihydroneopterin aldolase; FolB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33104"
FT                   /db_xref="GOA:E4TZL6"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL6"
FT                   /protein_id="ADR33104.1"
FT                   /translation="MKILIENLTFDAIIGILDFERTDPQQVQIDCTIDYTYTGDNFINY
FT                   ADIACMIETTVQTEQFELIETALEVLAAKLKLSFPLIDALSLTFRKPNILPNCTVGVQK
FT                   NFIF"
     atgaaaatat taatcgagaa tcttaccttc gatgcgatca tcgggattct cgattttgag        60
     cgtaccgacc cacaacaggt gcaaatcgac tgcactatcg actataccta caccggcgac       120
     aatttcatca attacgccga catagcctgc atgattgaaa caaccgtaca aacggagcaa       180
     tttgagctga ttgaaactgc tcttgaggtt ctcgcagcaa aattaaagct ctcttttccg       240
     ttaatcgatg ccctttcact taccttccga aaaccgaata ttcttccaaa ttgcaccgtc       300
     ggtgttcaaa aaaatttcat tttttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page