(data stored in ACNUC7421 zone)

EMBL: CP002355.PE437

CP002355.PE437       Location/Qualifiers
FT   CDS_pept        complement(427040..427654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0438"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="COGs: COG0344 membrane protein; InterPro IPR020788:
FT                   IPR003811; KEGG: tdn:Suden_0666 putative
FT                   glycerol-3-phosphate acyltransferase PlsY; PFAM: protein of
FT                   unknown function DUF205; SPTR: Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF205);
FT                   TIGRFAM: acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33105"
FT                   /db_xref="GOA:E4TZL7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL7"
FT                   /protein_id="ADR33105.1"
FT                   /translation="MDFLFNLNVQFYLAAYLLGGIPFGLILAKVFAGVNITEAGSQSIG
FT                   ATNVLRVVKETNPSLAKKLGAATLALDALKGIIVVLAAKYFELSDSAQWLVAVLAVVGH
FT                   CFSPYMWFEGGKGVATGMGVMAVMLPVPTVIALVVWAVAAKTIRISSLSSMLGLAALVV
FT                   SSFILYPAMFHAPVLFIAFILFYKHIPNFVRLVKGEEKRVA"
     atggattttt tatttaatct caatgttcaa ttttacctcg ccgcctatct tttgggcggg        60
     atcccgttcg gactcatttt ggcaaaagtg ttcgccggag tcaatattac cgaagccgga       120
     tcacaaagca tcggagctac gaatgttttg cgcgttgtca aagagaccaa cccctctctc       180
     gcgaaaaaac tgggtgcggc aaccctcgca ctcgatgcac ttaaagggat tattgtcgtc       240
     ctggccgcca aatacttcga actcagcgac agcgcccaat ggcttgttgc cgtcttggcg       300
     gttgtcggac actgctttag cccgtatatg tggtttgaag ggggcaaagg ggttgcgacg       360
     gggatgggcg ttatggcagt catgcttccg gtcccgacgg taatcgctct ggtcgtatgg       420
     gcggttgccg ccaaaacaat ccgtatctca tcactttctt cgatgctcgg gcttgccgct       480
     cttgtcgtct cctcatttat cctttatcct gcgatgtttc acgctccggt actttttatc       540
     gcttttatcc ttttttataa acatatcccc aactttgtcc gccttgtcaa aggggaagag       600
     aaacgggtcg catga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page