(data stored in ACNUC7421 zone)

EMBL: CP002355.PE438

CP002355.PE438       Location/Qualifiers
FT   CDS_pept        427808..428800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0439"
FT                   /product="quinolinate synthetase A"
FT                   /EC_number="2.5.1.72"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: tdn:Suden_0667 quinolinate synthetase;
FT                   PFAM: Quinolinate synthetase A; PRIAM: Quinolinate
FT                   synthase; SPTR: Quinolinate synthetase complex, A subunit;
FT                   TIGRFAM: quinolinate synthetase complex, A subunit; PFAM:
FT                   Quinolinate synthetase A protein; TIGRFAM: quinolinate
FT                   synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33106"
FT                   /db_xref="GOA:E4TZL8"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL8"
FT                   /protein_id="ADR33106.1"
FT                   /translation="MNTEELKQKIIDLKNRLSVTVVAHFYQRDEVFEMGDITGDSLELA
FT                   KRTMADDKEFVVFCGVGFMGQSVKILSPEKRVVMPKVACCAMAKMIDGLYYDQSIAKLE
FT                   EAGIKADDILPITYINSDAAVKARVGKMGGMVCTSSNAKIIITKALGEGKKILFVPDRC
FT                   LGQNIARQMGLKSCVIGDGTDPKEADIICYDGFCSVHQLFSVEDIEFYRNKYPGILIAV
FT                   HPECDPAICERADFVGSTSQLIKYITELPANQKVAVGTEFNMVNRLRPSNTYILSSTKP
FT                   ECPTMNETTLEDLYAVLKSIEEGAPINEIEVDEDTAHWAKIALERMMAL"
     ttgaataccg aagaattgaa acaaaaaatc atcgatttaa aaaatcgcct cagtgtaacg        60
     gtcgtagcac acttctatca acgcgacgaa gtgttcgaga tgggggatat taccggcgat       120
     tcgcttgagc ttgccaagcg cactatggcg gatgataaag agttcgtcgt attttgcggt       180
     gtgggattta tgggacaaag cgtcaaaatc ctcagccctg aaaaacgggt cgtgatgccg       240
     aaagtcgcct gctgtgcgat ggcaaaaatg atcgacggac tctattacga ccagtcgatc       300
     gctaagctag aagaagcagg aatcaaagcg gacgatattt taccgatcac ctatatcaat       360
     tccgatgcag ccgtcaaagc ccgtgtcggg aaaatggggg ggatggtctg caccagttcc       420
     aatgcgaaga taattatcac taaggcgctg ggtgagggga aaaagatttt attcgtcccc       480
     gatcgctgtc tggggcagaa tatcgctcgt cagatggggc tgaaatcgtg tgtcatcgga       540
     gacggaaccg accccaaaga agccgatatc atctgctacg acgggttctg ctccgttcat       600
     cagctcttca gtgtagagga catcgagttc tatcgcaata aatatccggg gattttgatc       660
     gccgtccacc ccgagtgtga tcccgctatc tgcgagcgtg ccgattttgt cggctctacc       720
     tctcagctga tcaaatacat cacggaactt ccggcgaatc aaaaagtggc agtcgggaca       780
     gagtttaata tggtcaatcg cctccgtccg agtaatacct atatcctctc atcgacgaaa       840
     ccggagtgtc cgacgatgaa cgagacgacg ttggaagatt tgtatgcggt tcttaaatcg       900
     atcgaggaag gtgcgccgat caatgagatc gaggtggacg aagatacggc acactgggca       960
     aaaatcgcgt tagagaggat gatggcgtta tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page