(data stored in ACNUC7421 zone)

EMBL: CP002355.PE439

CP002355.PE439       Location/Qualifiers
FT   CDS_pept        428797..429612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0440"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR004393: IPR002638; KEGG:
FT                   tdn:Suden_0668 nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; PRIAM:
FT                   Nicotinate-nucleotide diphosphorylase (carboxylating);
FT                   SPTR: Nicotinate-nucleotide pyrophosphorylase; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase, C-terminal domain; Quinolinate
FT                   phosphoribosyl transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33107"
FT                   /db_xref="GOA:E4TZL9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZL9"
FT                   /protein_id="ADR33107.1"
FT                   /translation="MIEQFIREVLAEDVGRGDLYARVSDAVSASAKIIAKSDGVIAGEA
FT                   YLKVLAEIEKFNIIWHKHDGDRFVKGEVLMELSGDSHTLLRIERTLLNMLLHASSIATL
FT                   TRKYVDLIAPYGTKLLDTRKTRPLLRNFEKYATRIGGATNHRMGLDDALMLKDTHLKTI
FT                   TNLESFMEEARKKIPFTSKIEIEAEDFEMAAHAMRCGADIVMCDNMTVEQLTEVVKYKW
FT                   EHHSGVLLEASGNITLETIEAYAASGVDAISTGALIHQANWIDMSMKMD"
     atgatcgaac aatttatccg tgaagtcttg gccgaagatg tagggcgtgg ggatctatac        60
     gcacgggtat ccgatgcggt gagcgccagt gcgaagatta tcgccaaaag tgacggagtg       120
     attgcgggag aagcatatct gaaggtattg gcggagatcg agaaatttaa catcatatgg       180
     cacaagcatg atggcgatcg atttgtaaaa ggggaggtat tgatggagtt gagcggcgat       240
     tcccataccc ttcttcggat cgagcggact cttctaaaca tgcttcttca tgccagttcc       300
     attgcgacac tgacccgcaa atacgtcgat ttgatcgcac cgtacgggac gaaactcctc       360
     gacacccgta aaacccgtcc gctcttgcgc aattttgaaa aatacgccac ccgtatcggg       420
     ggggcgacaa accacagaat ggggctggac gatgcgctga tgctcaaaga cacccacctc       480
     aaaacgatca cgaatttgga aagttttatg gaagaggcgc gtaaaaaaat cccctttacc       540
     tccaaaatcg agatcgaggc cgaagatttc gagatggcgg cccatgcgat gcgttgcggc       600
     gccgatatcg tcatgtgcga caacatgacc gtcgaacagc ttactgaagt cgttaaatac       660
     aaatgggaac accacagcgg cgtattactc gaagcgagcg gaaatatcac cttagagacg       720
     atcgaagcgt atgctgcgag cggagtcgat gcgatcagta cgggtgctct tatccatcaa       780
     gcgaattgga ttgatatgtc catgaaaatg gattaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page