(data stored in ACNUC7421 zone)

EMBL: CP002355.PE440

CP002355.PE440       Location/Qualifiers
FT   CDS_pept        429616..430683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0441"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="COGs: COG1377 Flagellar biosynthesis pathway
FT                   component FlhB; InterPro IPR006136: IPR006135; KEGG:
FT                   tdn:Suden_0669 flagellar biosynthesis protein FlhB; PFAM:
FT                   type III secretion exporter; SPTR: Flagellar biosynthetic
FT                   protein FlhB; TIGRFAM: flagellar biosynthetic protein FlhB;
FT                   PFAM: FlhB HrpN YscU SpaS Family; TIGRFAM: flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33108"
FT                   /db_xref="GOA:E4TZM0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM0"
FT                   /protein_id="ADR33108.1"
FT                   /translation="MADDQEKTEEPTAKKLEDARAEGNVPKSQDVVGVVVLFVSILAVL
FT                   MMFTFIADRMLHLSQYYFSLMRQPLDRELMVDLAVVTMKEFLIMALPVSIIVAVAGVFG
FT                   TVAQIGFNFTTKPLTPNFSKLDPIKGFANLFTLQKGLESIKITLKSFTALGIGFLYFWY
FT                   FVEELPTVALFTLQDQMGWLRDKAIVLASVMLLIIFVYAVIDLFLVRKHYFDKLKMSLQ
FT                   EIKDEMKNMEGDPHIKAKIRQIQMQAARKRMMTSVPTADVVITNPTHYAVAIVYDENKH
FT                   NAPVVVAKGVDNMAIQIKKVARENGVHIVQNPPLARSLYKEVDIDHPIPDMLFAAVAEV
FT                   LAYVYKMGKKRKGNS"
     gtggcagacg atcaagaaaa gaccgaagaa cccaccgcca agaagctcga agatgcccga        60
     gccgaaggga acgtccccaa aagtcaggat gttgtagggg tcgttgtcct ttttgtctcc       120
     attttggcgg ttttaatgat gtttacgttt atcgccgatc ggatgcttca tctttcccag       180
     tattattttt ctttgatgcg tcagcctctg gaccgtgaat tgatggttga tttggcggta       240
     gtaacgatga aagagttcct catcatggca cttcctgttt caatcatcgt agccgttgcg       300
     ggagtgttcg gaacggtagc ccagatcgga tttaatttta cgacaaaacc tctgacaccc       360
     aacttttcca aactcgatcc gatcaaagga ttcgccaacc tttttaccct ccaaaaaggg       420
     cttgagtcga tcaaaataac attgaagtct tttacggcac tcgggatcgg atttctctat       480
     ttttggtatt tcgttgaaga acttcccacc gttgcgctgt ttacgctaca agatcagatg       540
     ggatggctta gggacaaagc gatcgttctg gcttcggtca tgcttctcat tatttttgtt       600
     tatgccgtta tcgatctttt tttggtacgg aaacactatt ttgacaaatt gaaaatgtcg       660
     cttcaagaga tcaaagacga gatgaaaaat atggaagggg atccgcatat caaggcgaag       720
     atccgtcaga tccagatgca ggcggcgaga aaacggatga tgacttcggt accgaccgcc       780
     gatgtcgtta ttaccaaccc gacccattac gcggtggcga tcgtgtatga tgaaaacaag       840
     cataatgctc cggtagtagt agccaaaggg gtggacaata tggcgattca aatcaaaaag       900
     gtagcgagag aaaacggtgt ccacatcgtt cagaatccgc cgttggcacg atctctttac       960
     aaagaggtag atatcgatca tccgataccc gatatgttgt ttgccgccgt tgccgaggtc      1020
     cttgcatatg tctataaaat gggcaaaaaa cggaaaggaa atagctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page