(data stored in ACNUC7421 zone)

EMBL: CP002355.PE441

CP002355.PE441       Location/Qualifiers
FT   CDS_pept        430683..431810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0257 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33109"
FT                   /db_xref="GOA:E4TZM1"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM1"
FT                   /protein_id="ADR33109.1"
FT                   /translation="MERWVGLLSNKKVIASVFLVIMAILGIVLWQLEKKVTSQTLERLS
FT                   DQLSLAINNQLEKERSSALRYALILSQNTALSDALERDDEDKGFKILSEGMESIKVHTD
FT                   SLIRSQVITSDYVIFARSWDNSYAGMPLEFHRPDLLYFQNHKNPRSAIEVGRKLGVKAT
FT                   VPVYRDDKMLGFVEVVSFFESTQEYFDRLGIDMYVLMDVRFYDTAVFMQENPTIAKEYI
FT                   LANPKYTQSDLKLLNGIDFKTLKHTHVVFSGGRYLFFEPMKNGEGETIGAFVFSLSPKQ
FT                   INAYAHSDEEDISFLIHLSRNELYDVMIKKSLDDGLFQSVYDKELLYLKDTVAPEDREL
FT                   FVQEAHERLDAYSKEELIGIMLNYKVTKEIKGEIR"
     atggaacgct gggtagggct tctttccaat aaaaaagtca ttgcttccgt ctttttagtc        60
     attatggcga tattgggaat cgtattgtgg cagctggaga aaaaggtaac ttcgcagaca       120
     ctggaacgtt tgagtgacca actctccttg gccattaaca atcagcttga aaaagagcgc       180
     tccagcgcat tgcgttatgc attgatcctt tctcaaaata cagccctgag cgatgcattg       240
     gaacgagacg atgaggataa aggatttaaa atcctctcgg aggggatgga atcgatcaaa       300
     gtgcataccg actcactgat ccgctctcag gttattacct ccgactacgt gattttcgcc       360
     cgcagctggg ataattcgta tgccgggatg ccgctggagt ttcaccgtcc cgatctgctc       420
     tattttcaaa accataaaaa cccccgctcc gctatcgaag tgggacgaaa gctgggggtt       480
     aaagcgacgg ttccggtcta tcgagatgac aaaatgctcg gatttgtgga ggttgtatcg       540
     tttttcgaat cgacgcagga gtattttgac cgtctcggga tcgatatgta tgtcctgatg       600
     gatgtgagat tttacgatac ggcggtgttt atgcaggaaa accctaccat cgcaaaagag       660
     tatattcttg ccaatccgaa gtacacccag agcgatttga aacttttaaa cgggatcgac       720
     tttaaaacgc tgaaacatac gcacgttgtt ttcagcggag ggcgatatct atttttcgaa       780
     ccgatgaaaa acggggaagg ggagacgatc ggtgcgttcg ttttttccct ctccccgaag       840
     cagatcaatg cctatgccca ctccgatgaa gaggatattt cgtttcttat ccacctttcg       900
     cgcaacgaac tttatgatgt gatgataaaa aaatcgctgg atgacggact gtttcaaagc       960
     gtatacgata aagagctgct ctacctcaaa gatacggttg cccctgaaga tcgggaactg      1020
     tttgtgcaag aggcccatga acgcctcgat gcgtattcaa aagaggaatt gatcggaatc      1080
     atgctaaatt acaaggtaac caaagagatt aaaggggaga tacgatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page