(data stored in ACNUC7421 zone)

EMBL: CP002355.PE442

CP002355.PE442       Location/Qualifiers
FT   CDS_pept        431807..432460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0443"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: tdn:Suden_0258
FT                   two component transcriptional regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator
FT                   domain-containing protein; SMART: response regulator
FT                   receiver; SPTR: Two component transcriptional regulator,
FT                   winged helix family; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33110"
FT                   /db_xref="GOA:E4TZM2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM2"
FT                   /protein_id="ADR33110.1"
FT                   /translation="MRVLLLEDEYMLRVSITEFLEELGYEVAGFSNGEKAYDAIYETRF
FT                   DLYLLDVNVPGMNGFELLRALRKEGNKTPAIFLTSMVNVNDLQEGYKSGCCDYIRKPFD
FT                   LTELQLRIMHALKSHYHDGENTIDFGGGLVYDTEHFSLNHNDKAIALSKTEKEIFAVLL
FT                   KHTNQIVSVEMFQDEIWGEYVDPANIRVQINNLRKKLPLDIIQNRRGLGYIIER"
     atgagagtat tattgctcga agacgagtat atgctgcgtg taagcatcac cgaatttttg        60
     gaagaactgg gctatgaagt ggccggattc agcaacggcg aaaaagcgta cgatgcgatt       120
     tacgaaaccc ggtttgatct gtatctcctc gatgtgaatg ttcctgggat gaacgggttt       180
     gagctattga gagcattgcg taaagagggg aataaaacac cggcgatatt tctcacctcg       240
     atggttaatg tcaacgatct gcaagagggg tataaatcgg ggtgctgcga ctatatccga       300
     aaaccgtttg atctgaccga actgcagctg cggatcatgc atgcccttaa aagccattat       360
     cacgacggtg agaataccat cgatttcggc ggcgggctgg tgtacgatac ggaacatttc       420
     agcctgaacc acaacgataa agcgatagct ctctccaaaa ccgaaaaaga gatttttgcc       480
     gtattgctca aacatacgaa tcagatcgtc tccgtcgaga tgttccagga tgagatttgg       540
     ggagaatacg tcgaccccgc aaatattcgg gttcagatta acaacttgcg taaaaaactg       600
     cctctcgaca ttatccaaaa ccgtcggggc ttgggataca tcattgaacg ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page