(data stored in ACNUC7421 zone)

EMBL: CP002355.PE445

CP002355.PE445       Location/Qualifiers
FT   CDS_pept        434233..434703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0446"
FT                   /product="thiosulfate-binding protein SoxY"
FT                   /note="COGs: COG5501 secreted protein; InterPro IPR006311:
FT                   IPR016568: IPR017909; KEGG: sun:SUN_0498 sulfur oxidation
FT                   protein SoxY; SPTR: Twin-arginine translocation pathway
FT                   signal; TIGRFAM: Tat (twin-arginine translocation) pathway
FT                   signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33113"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM5"
FT                   /protein_id="ADR33113.1"
FT                   /translation="MERRSFLKGFGAAAACAIALPHVASAAEEKKSGGPNEMNFETAVA
FT                   AITGGKALTPSAKVKMEAPEIAENGAVVPVKVTVDSPMSAKEYVKAIHILASKNGNVRC
FT                   ANIYLTPANGEAYFGTRIKLGGTQDVVAIAEMSDGTFLSAKQNVKVTIGGCG"
     atggaaagaa gatcattttt aaaaggtttt ggagcagcgg cagcatgtgc gattgcattg        60
     cctcatgtgg ctagtgcggc agaagagaaa aaatctggcg gtccgaatga gatgaatttt       120
     gagacggcag tagcggctat taccggcggt aaagcgttaa ctccttctgc aaaagtcaaa       180
     atggaagcac ctgaaattgc agaaaacggt gcagttgtac cggttaaagt aaccgttgat       240
     agcccgatga gcgcaaaaga gtacgtgaaa gcgattcata ttcttgcatc gaaaaacgga       300
     aatgtacgtt gtgcgaatat ctatctaaca ccggcaaacg gcgaagccta tttcggtact       360
     cgtattaaac tcggcggaac acaggatgtt gtagctattg ccgagatgag cgacgggacg       420
     tttcttagtg caaagcaaaa tgtaaaagtc accatcggcg gatgcggttg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page