(data stored in ACNUC7421 zone)

EMBL: CP002355.PE446

CP002355.PE446       Location/Qualifiers
FT   CDS_pept        434753..435079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0447"
FT                   /product="sulfur compound chelating protein SoxZ"
FT                   /note="InterPro IPR014880; KEGG: nis:NIS_1830 hypothetical
FT                   protein; PFAM: Sulphur oxidation protein SoxZ; SPTR:
FT                   Putative uncharacterized protein; PFAM: Sulphur oxidation
FT                   protein SoxZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33114"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM6"
FT                   /protein_id="ADR33114.1"
FT                   /translation="MKTLIKIKPKDYKAGDIVKIDFMAMHPMETGMRKNKDTGALIPAE
FT                   YIDEVKFMFNDTLITKMVIWESLSVNPLMSISFKVPGAGTLKVIAKDNKGQSVETTSAI
FT                   NPKG"
     atgaaaacac tgattaaaat caaaccgaaa gattataaag cgggcgatat cgttaaaatc        60
     gattttatgg cgatgcaccc gatggaaacc ggtatgcgta aaaacaaaga tacgggagca       120
     ttgattccgg ctgaatatat cgatgaagta aaatttatgt tcaacgatac gttgattacc       180
     aaaatggtga tctgggaatc tctctcggtg aaccctctta tgagtatcag ctttaaagta       240
     ccgggtgcgg gaaccctaaa agttattgca aaagataaca aagggcaaag tgtcgaaacg       300
     accagtgcca ttaatccaaa aggataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page