(data stored in ACNUC7421 zone)

EMBL: CP002355.PE447

CP002355.PE447       Location/Qualifiers
FT   CDS_pept        435083..435856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0448"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR009056; KEGG: nis:NIS_1829 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33115"
FT                   /db_xref="GOA:E4TZM7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E4TZM7"
FT                   /protein_id="ADR33115.1"
FT                   /translation="MRTLSITAALVCLAFLATANAEEKLSMSDADKKMYAELLESNPAE
FT                   MDVAEGEQLFGELIGNANYAKMLGVKEKDLPKFIAGFPRYLEPAKRVVTIAQSIQMAAA
FT                   ANDKPVPKLESNEMVKMSAYVKSIANGQKTNIDVKANKHMVEMMKLGQQVFEERRGGRG
FT                   LSCNNCHSADIVGQRLRMQPLPDLGAKETAAAGTWPAYRMTQSQMVTLDKRMQQCMKNA
FT                   LLAEIPLGSKEIVALEVFVTNKTKGNNISVPSVKR"
     atgcgtacgt tatcaatcac ggctgcatta gtgtgtttag catttttagc gacggcgaat        60
     gcggaagaaa agcttagcat gtcggatgcg gacaaaaaaa tgtatgccga gcttttggaa       120
     agcaacccag ctgaaatgga tgtagccgag ggggagcaac tcttcggtga acttatcggg       180
     aatgcgaact atgccaaaat gctgggagtc aaagagaaag atcttccgaa attcatcgca       240
     ggatttcctc gttaccttga gccggctaaa agagtagtga cgatagcaca gagtatccaa       300
     atggcagctg ctgcaaatga caaaccggtt cctaagctcg agagcaatga gatggttaaa       360
     atgtctgcgt atgtgaaatc aatcgcaaac ggacaaaaaa ccaatatcga tgtaaaagcg       420
     aacaaacata tggttgagat gatgaaactc ggacagcaag tgttcgaaga gcgtcgaggc       480
     ggtcgcggac tatcatgtaa caactgccac agtgccgata tcgtcggtca gcgtctacgt       540
     atgcagccgc tacctgattt gggagcgaaa gagacggcag cagcaggaac atggccggcg       600
     taccgtatga cgcaaagcca aatggtaacg ttggacaaac ggatgcagca atgtatgaaa       660
     aatgctcttt tggctgaaat tccactcggt tcgaaagaga ttgttgcttt ggaagtattc       720
     gtaaccaaca aaaccaaagg gaacaatatc agtgttccta gcgtgaaacg ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page